Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q13434
Symbols MKRN4
RNF64
MKRNP5
ZNF-Xp
ZNF127L1
ZNF127-Xp

Gene

PANTHER Protein Class (2)

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MAEAAAPGTTVTTSGAGAAAAEAAETAEAVSPTPIPTVTAPSPRAGGGVGGSDGSDGSGGRGDSGAYDGS      1 - 70
GACGGSDACDGSGDSSGDSWTKQVTCRYFKYGICKEGDNCRYSHDLSDRLCGVVCKYFQRGCCVYGDRCR     71 - 140
CEHSKPLKQEEATATELTTKSSLAASSSLSSIVGPLVEMNTNEAESRNSNFATVVAGSEDWANAIEFVPG    141 - 210
QPYCGRTVPSCTEAPLQGSVTKEESEEEQTAVETKKQLCPYAAVGQCRYGENCVYLHGDLCDMCGLQVLH    211 - 280
PMDAAQRSQHIQACIEAHEKDMEFSFAVQRSKDKVCGICMEVVYEKANPNEHRFGILSNCNHTFCLKCIR    281 - 350
KWRSAKEFESRIVKSCPQCRITSNFVIPSEYWVEEKEEKQKLIQKYKEAMSNKACKYFDEGRGSCPFGEN    351 - 420
CFYKHMYPDGRREEPQRQQVGTSSRNPGQQRNHFWEFFEEGANSNPFDDEEEAVTFELGEMLLML         421 - 485
//