Property Summary

NCBI Gene PubMed Count 196
Grant Count 342
R01 Count 218
Funding $41,794,137.84
PubMed Score 453.12
PubTator Score 438.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Synonym

Accession Q13422 A4D260 B4E0Z1 D3DVM5 O00598 Q53XL2 Q69BM4 Q8WVA3
Symbols IK1
LYF1
LyF-1
CVID13
IKAROS
PPP1R92
PRO0758
ZNFN1A1
Hs.54452

Gene

Gene RIF (152)

PMID Text
26981933 Heterozygous mutations in the transcription factor IKAROS caused an autosomal dominant form of CVID that is associated with a striking decrease in B-cell numbers.
26704074 IKZF1 deletions were detected in 28.7% B-ALL patients, were more common in BCR-ABL positive and adult B-ALL, and correlated with higher induction failure
26655717 the presented data suggest a mechanism through which Ikaros and HDAC1 regulate the epigenetic signature in leukemia: via regulation of JARID1B transcription.
26575870 IKZF1 deletion still affected the children's disease-free survival
26517351 Data indicate an oncogenic role for an Ikaros protein/MYCBP2 protein/proto-oncogene protein c-MYC axis in adult acute lymphoblastic leukemia (ALL), providing a mechanism of target therapies that activate Ikaros in ALL.
26448174 We conducted a genome-wide association study for Cold Medicine related -Stevens-Johnson Syndrome /Toxic epidermal necrolysis with SOCs and found that IKZF1 single-nucleotide polymorphisms (SNPs) were significantly associated.
26202931 all variants of rare IKZF1 deletions are associated with an unfavorable prognosis in pediatric BCP-ALL.
26183205 Data indicate that transcription factor IKZF1 is degraded through apoptosis induced by kinase inhibitors in myeloma cells.
26119939 The anti-PEL effects of IMiDs involved cereblon-dependent suppression of IRF4 and rapid degradation of IKZF1, but not IKZF3. Small hairpin RNA-mediated knockdown of MYC enhanced the cytotoxicity of IMiDs
26104880 Non-coding variant rs4132601 in IKZF1 was strongly associated with childhood B-cell acute lymphoblastic leukemia. No coding variants were associated with B-ALL susceptibility.
More...

AA Sequence

MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRA      1 - 70
CEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHT     71 - 140
GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSY    141 - 210
KQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQ    211 - 280
KFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL    281 - 350
HKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP    351 - 420
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPF    421 - 490
ECNMCGYHSQDRYEFSSHITRGEHRFHMS                                             491 - 519
//

Text Mined References (204)

PMID Year Title
26981933 2016 Loss of B Cells in Patients with Heterozygous Mutations in IKAROS.
26704074 2016 IKZF1 (IKAROS) deletions in B-ALL and its clinical correlation: A prospective study from a tertiary care centre in Northern India.
26655717 2016 Transcriptional Regulation of JARID1B/KDM5B Histone Demethylase by Ikaros, Histone Deacetylase 1 (HDAC1), and Casein Kinase 2 (CK2) in B-cell Acute Lymphoblastic Leukemia.
26575870 2015 [Significance of IKZF1 gene copy number abnormalities in BCR/ABL-negative B-lineage acute lymphoblastic leukemia in children].
26517351 2015 Clinical significance of high c-MYC and low MYCBP2 expression and their association with Ikaros dysfunction in adult acute lymphoblastic leukemia.
26448174 2015 Genetic Predisposition to Stevens-Johnson Syndrome With Severe Ocular Surface Complications.
26202931 2016 Prognostic value of rare IKZF1 deletion in childhood B-cell precursor acute lymphoblastic leukemia: an international collaborative study.
26183205 2015 Transcription factor IKZF1 is degraded during the apoptosis of multiple myeloma cells induced by kinase inhibition.
26119939 2016 Immunomodulatory drugs target IKZF1-IRF4-MYC axis in primary effusion lymphoma in a cereblon-dependent manner and display synergistic cytotoxicity with BRD4 inhibitors.
26104880 2015 Inherited coding variants at the CDKN2A locus influence susceptibility to acute lymphoblastic leukaemia in children.
More...