Property Summary

NCBI Gene PubMed Count 222
PubMed Score 483.58
PubTator Score 438.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Cancer 2499 4.925 2.5
Trichorhinophalangeal syndrome type I 8 3.038 1.5
Disease Target Count
Stevens-Johnson syndrome 92

Expression

  Differential Expression (20)

Disease log2 FC p
ulcerative colitis 1.100 6.3e-04
adult high grade glioma 1.500 4.2e-03
Astrocytoma, Pilocytic 1.900 8.3e-08
Breast cancer -1.200 6.7e-04
cutaneous lupus erythematosus 1.800 4.2e-03
glioblastoma 1.200 4.2e-04
group 3 medulloblastoma -1.100 1.8e-02
hepatocellular carcinoma 1.400 1.8e-05
interstitial cystitis 1.400 7.1e-03
intraductal papillary-mucinous carcinoma... -2.300 8.4e-03
intraductal papillary-mucinous neoplasm ... -2.500 2.3e-02
lung cancer -2.200 3.1e-04
lung carcinoma -1.900 9.4e-25
non-small cell lung cancer -1.357 7.2e-10
osteosarcoma -2.558 1.4e-07
ovarian cancer -1.900 5.6e-05
periodontitis 1.300 8.3e-26
primary Sjogren syndrome 1.100 6.9e-03
Rheumatoid arthritis 1.200 6.8e-03
subependymal giant cell astrocytoma 1.694 2.3e-02

Gene RIF (177)

AA Sequence

MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRA      1 - 70
CEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHT     71 - 140
GERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVGKPHKCGYCGRSY    141 - 210
KQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQ    211 - 280
KFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVISPMYQL    281 - 350
HKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAP    351 - 420
HARNGLSLKEEHRAYDLLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPF    421 - 490
ECNMCGYHSQDRYEFSSHITRGEHRFHMS                                             491 - 519
//

Text Mined References (230)

PMID Year Title