Property Summary

NCBI Gene PubMed Count 121
Grant Count 244
R01 Count 40
Funding $50,285,230.47
PubMed Score 422.08
PubTator Score 349.79

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PDB

4F3F  

Gene RIF (105)

PMID Text
26536664 Results indicate a specific mesothelin-driven tumor uptake of targeted 89zirconium-labeled antibody which visualizes mesothelin expressing pancreatic cancer in real time.
26188910 There was a trend toward elevation of SMRP values in healthy individuals exposed to asbestos compared to those without exposure. Within asbestosis cases, those with higher profusion scores had higher SMRP values than those with lower profusion scores.
26172299 Data indicate that triple-negative breast cancer (TNBC) showed the highest amplification rate (42%) in the basal-like 1 subtype.
26028668 High mesothelin expression was strongly associated with mutant KRAS/wild-type EGFR and poor prognosis in advanced lung cancer.
25776500 Expression of mesothelin was observed in 42.3% of patients with triple negative breast cancer.
25506917 Patients with mesothelin-positive triple negative breast carcinomas (TNBC) were older than patients with mesothelin-negative TNBC, developed more distant metastases with a shorter interval, and had significantly lower overall and disease-free survival.
25505814 Pleural fluid mesothelin may serve as a marker for pleural malignant mesothelioma.
25477701 Patients with colon cancer had significantly higher mesothelin serum levels than the control groups.
25436799 findings replicate association between rs1057147 and soluble mesothelin related peptide(SMRP)levels; SMRP performance as diagnostic biomarker for malignant pleural mesothelioma improved by considering genotype rs1057147; this polymorphism most likely affects a binding site for miR-611
25378643 Delivery of mesothelin-targeted CAR T cells eradicates tumors in mice with pleural malignancies.
More...

AA Sequence

MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLSPRQLLGFP      1 - 70
CAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRF     71 - 140
FSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVS    141 - 210
CPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPS    211 - 280
WRQPERTILRPRFRREVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLD    281 - 350
VLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVA    351 - 420
TLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARL    421 - 490
AFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKA    491 - 560
EERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGPVLTVLALLLASTLA    561 - 630
//

Text Mined References (123)

PMID Year Title
26536664 2015 Imaging the distribution of an antibody-drug conjugate constituent targeting mesothelin with ??Zr and IRDye 800CW in mice bearing human pancreatic tumor xenografts.
26188910 2015 Mesothelin (MSLN) methylation and soluble mesothelin-related protein levels in a Chinese asbestos-exposed population.
26172299 2015 Functional genomic mRNA profiling of a large cancer data base demonstrates mesothelin overexpression in a broad range of tumor types.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26028668 2015 High mesothelin expression in advanced lung adenocarcinoma is associated with KRAS mutations and a poor prognosis.
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25776500 2015 Prognostic value of mesothelin expression in patients with triple negative and HER2-positive breast cancers.
25506917 2014 Mesothelin expression in triple negative breast carcinomas correlates significantly with basal-like phenotype, distant metastases and decreased survival.
25505814 2014 Pleural fluid mesothelin as an adjunct to the diagnosis of pleural malignant mesothelioma.
25477701 2014 Preoperative serum levels of mesothelin in patients with colon cancer.
More...