Property Summary

NCBI Gene PubMed Count 131
PubMed Score 452.07
PubTator Score 349.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.200 8.6e-07
cystic fibrosis -1.300 5.5e-03
esophageal adenocarcinoma 1.800 1.9e-02
intraductal papillary-mucinous adenoma (... 3.200 2.8e-03
intraductal papillary-mucinous neoplasm ... 3.200 5.5e-04
lung carcinoma -1.400 6.6e-08
nasopharyngeal carcinoma -2.400 6.4e-06
non-small cell lung cancer -2.077 4.4e-08
ovarian cancer -2.300 6.6e-06
pancreatic cancer 3.800 3.9e-08
pancreatic ductal adenocarcinoma liver m... 3.064 2.2e-02
psoriasis -1.400 2.2e-11

 MGI Phenotype (1)

Gene RIF (115)

AA Sequence

MALPTARPLLGSCGTPALGSLLFLLFSLGWVQPSRTLAGETGQEAAPLDGVLANPPNISSLSPRQLLGFP      1 - 70
CAEVSGLSTERVRELAVALAQKNVKLSTEQLRCLAHRLSEPPEDLDALPLDLLLFLNPDAFSGPQACTRF     71 - 140
FSRITKANVDLLPRGAPERQRLLPAALACWGVRGSLLSEADVRALGGLACDLPGRFVAESAEVLLPRLVS    141 - 210
CPGPLDQDQQEAARAALQGGGPPYGPPSTWSVSTMDALRGLLPVLGQPIIRSIPQGIVAAWRQRSSRDPS    211 - 280
WRQPERTILRPRFRREVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLD    281 - 350
VLKHKLDELYPQGYPESVIQHLGYLFLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQAPRRPLPQVA    351 - 420
TLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPSSIWAVRPQDLDTCDPRQLDVLYPKARL    421 - 490
AFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLTVAEVQKLLGPHVEGLKA    491 - 560
EERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSMQEALSGTPCLLGPGPVLTVLALLLASTLA    561 - 630
//

Text Mined References (133)

PMID Year Title