Property Summary

NCBI Gene PubMed Count 20
PubMed Score 93.91
PubTator Score 28.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 0.0 1.2
Iron metabolism disease 20 0.0 2.9
Disease Target Count Z-score Confidence
Batten disease 13 5.629 2.8

Expression

Gene RIF (2)

AA Sequence

MAVFPSSGLPRCLLTLILLQLPKLDSAPFDVIGPPEPILAVVGEDAELPCRLSPNASAEHLELRWFRKKV      1 - 70
SPAVLVHRDGREQEAEQMPEYRGRATLVQDGIAKGRVALRIRGVRVSDDGEYTCFFREDGSYEEALVHLK     71 - 140
VAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASVIIRD    141 - 210
TSAKNVSCYIQNLLLGQEKKVEISIPASSLPRLTPWIVAVAVILMVLGLLTIGSIFFTWRLYNERPRERR    211 - 280
NEFSSKERLLEELKWKKATLHAVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQKLPEKTERFDSWPCVLGR    281 - 350
ETFTSGRHYWEVEVGDRTDWAIGVCRENVMKKGFDPMTPENGFWAVELYGNGYWALTPLRTPLPLAGPPR    351 - 420
RVGIFLDYESGDISFYNMNDGSDIYTFSNVTFSGPLRPFFCLWSSGKKPLTICPIADGPERVTVIANAQD    421 - 490
LSKEIPLSPMGEDSAPRDADTLHSKLIPTQPSQGAP                                      491 - 526
//

Text Mined References (21)

PMID Year Title