Property Summary

NCBI Gene PubMed Count 21
Grant Count 16
R01 Count 14
Funding $1,331,942.8
PubMed Score 33.83
PubTator Score 43.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26808411 The results answer the question of how MAGP2 controls cell type dependent Notch signaling, but more importantly uncover a new mechanism to understand how extracellular matrices and cellular environments impact Notch signaling.
26054006 Our results demonstrate that factors involving low-grade inflammation modulate MFAP5 expression and that the modified expression of MFAP5 may further regulate adipose tissue inflammation.
25434006 Alteration of MAGP-2, a component of microfibrils and elastic fibers, appears as an initiating mechanism of inherited Thoracic aortic aneurysm and dissection (TAAD).
25277212 FAK/CREB/TNNC1 has a role in mediating the effect of stromal MFAP5 on ovarian cancer metastatic potential
24496384 EPS led to the discovery of two novel immunomodulatory proteins, MFAP5 and PENK that when administered to mice subjected to endotoxemic shock, reversed the cytokine storm and provided a significant survival benefit
22885067 Decreased MFAP5 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment
20345228 The MAGP2-based assay provided superior performance for the purpose of cell culture identification compared to assays using standard reference genes.
19962670 Independent evaluation confirmed the association of a prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with poor prognosis in advanced ovarian cancer
18417156 MAGP-2 promotes angiogenic cell spouting in vitro by antagonizing Notch signaling pathways in endothelial cells.
16492672 microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway

AA Sequence

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD      1 - 70
DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC     71 - 140
RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL                                         141 - 173
//

Text Mined References (26)

PMID Year Title
26808411 2016 MAGP2 controls Notch via interactions with RGD binding integrins: Identification of a novel ECM-integrin-Notch signaling axis.
26054006 2015 MFAP5 is related to obesity-associated adipose tissue and extracellular matrix remodeling and inflammation.
25434006 2014 MFAP5 loss-of-function mutations underscore the involvement of matrix alteration in the pathogenesis of familial thoracic aortic aneurysms and dissections.
25277212 2014 Calcium-dependent FAK/CREB/TNNC1 signalling mediates the effect of stromal MFAP5 on ovarian cancer metastatic potential.
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
24496384 2014 Enriched protein screening of human bone marrow mesenchymal stromal cell secretions reveals MFAP5 and PENK as novel IL-10 modulators.
23963447 2013 Microfibril-associated glycoprotein 2 (MAGP2) loss of function has pleiotropic effects in vivo.
23201136 2013 Identification of a functional proprotein convertase cleavage site in microfibril-associated glycoprotein 2.
22885067 2012 NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
More...