Property Summary

NCBI Gene PubMed Count 24
PubMed Score 34.11
PubTator Score 43.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
AORTIC ANEURYSM, FAMILIAL THORACIC 9 1 0.0 0.0
Disease Target Count Z-score Confidence
Aortic aneurysm 38 0.0 4.0
Disease Target Count Z-score Confidence
Dysentery 10 3.758 1.9
Thoracic aortic aneurysm 15 3.382 1.7

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma -2.000 5.9e-07
adult high grade glioma 1.500 2.1e-03
Atopic dermatitis -3.000 6.4e-05
atypical teratoid / rhabdoid tumor 2.100 5.4e-03
Breast cancer 1.600 9.7e-06
breast carcinoma -1.400 4.4e-06
colon cancer -1.500 1.4e-02
cutaneous lupus erythematosus -1.300 3.0e-02
Duchenne muscular dystrophy 1.028 1.0e-03
ductal carcinoma in situ -2.400 1.6e-02
Endometriosis -1.312 1.5e-02
ependymoma 1.500 1.2e-03
fascioscapulohumeral muscular dystrophy 1.499 1.6e-04
fibroadenoma -1.800 1.5e-02
glioblastoma 1.500 2.3e-02
invasive ductal carcinoma -2.900 9.2e-03
limb girdle muscular dystrophy 2A 1.195 1.1e-03
lung cancer -1.900 1.0e-03
lung carcinoma -1.900 2.1e-05
malignant mesothelioma 3.400 3.6e-08
medulloblastoma, large-cell 1.400 3.4e-04
ovarian cancer 2.600 1.5e-02
pancreatic cancer 1.800 7.0e-03
pituitary cancer -1.400 2.1e-03
primary pancreatic ductal adenocarcinoma 2.016 9.7e-03
primary Sjogren syndrome 1.100 3.8e-02
psoriasis -1.900 1.3e-03
pterygium 1.200 3.7e-02
X-linked recessive Emery-Dreifuss muscul... 1.201 2.8e-02

 CSPA Cell Line (1)

Gene RIF (11)

AA Sequence

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD      1 - 70
DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC     71 - 140
RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL                                         141 - 173
//

Text Mined References (28)

PMID Year Title