Property Summary

NCBI Gene PubMed Count 21
PubMed Score 33.83
PubTator Score 43.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
malignant mesothelioma 3163 4.82105792732999E-8
adrenocortical carcinoma 1427 5.91876726097526E-7
breast carcinoma 1614 4.41316493526279E-6
lung carcinoma 2844 2.06501299911235E-5
Atopic dermatitis 944 6.42048067255868E-5
fascioscapulohumeral muscular dystrophy 100 1.5516353862251E-4
lung cancer 4473 1.64394131364447E-4
medulloblastoma, large-cell 6234 3.42468064183773E-4
inflammatory breast cancer 404 7.83946613809422E-4
Duchenne muscular dystrophy 602 9.9970784013362E-4
posterior fossa group A ependymoma 1511 0.0010821828765269
limb girdle muscular dystrophy 2A 156 0.00109041935921844
psoriasis 6685 0.00126240654742566
adult high grade glioma 2148 0.00206366245050361
pituitary cancer 1972 0.00213288961499533
atypical teratoid / rhabdoid tumor 4369 0.00540377436881862
pancreatic cancer 2300 0.00701165685900549
invasive ductal carcinoma 2950 0.00919247936992484
primary pancreatic ductal adenocarcinoma 1271 0.009684784349662
ovarian cancer 8492 0.0101705663583439
colon cancer 1475 0.0142708312652599
fibroadenoma 557 0.0150539865874216
ductal carcinoma in situ 1745 0.0156849446781429
cutaneous lupus erythematosus 1056 0.0157688797683559
Endometriosis 535 0.0193856939366602
glioblastoma 5572 0.0230845512119414
X-linked recessive Emery-Dreifuss muscular dystrophy 18 0.0277822996561135
pterygium 74 0.0367056287653806
primary Sjogren syndrome 789 0.0380807919503811
Disease Target Count Z-score Confidence
Aortic aneurysm 34 0.0 4.0
Disease Target Count Z-score Confidence
Dysentery 13 3.822 1.9
Thoracic aortic aneurysm 13 3.509 1.8

Expression

Synonym

Accession Q13361 B0AZL6 D3DUV1 Q7Z490 MFAP-5
Symbols AAT9
MP25
MAGP2
MAGP-2
MFAP-5

Gene

  Ortholog (8)

 CSPA Cell Line (1)

Gene RIF (10)

PMID Text
26808411 The results answer the question of how MAGP2 controls cell type dependent Notch signaling, but more importantly uncover a new mechanism to understand how extracellular matrices and cellular environments impact Notch signaling.
26054006 Our results demonstrate that factors involving low-grade inflammation modulate MFAP5 expression and that the modified expression of MFAP5 may further regulate adipose tissue inflammation.
25434006 Alteration of MAGP-2, a component of microfibrils and elastic fibers, appears as an initiating mechanism of inherited Thoracic aortic aneurysm and dissection (TAAD).
25277212 FAK/CREB/TNNC1 has a role in mediating the effect of stromal MFAP5 on ovarian cancer metastatic potential
24496384 EPS led to the discovery of two novel immunomodulatory proteins, MFAP5 and PENK that when administered to mice subjected to endotoxemic shock, reversed the cytokine storm and provided a significant survival benefit
22885067 Decreased MFAP5 gene expression in the endometrium of patients with implantation failure after in vitro ertilization treatment
20345228 The MAGP2-based assay provided superior performance for the purpose of cell culture identification compared to assays using standard reference genes.
19962670 Independent evaluation confirmed the association of a prognostic gene microfibril-associated glycoprotein 2 (MAGP2) with poor prognosis in advanced ovarian cancer
18417156 MAGP-2 promotes angiogenic cell spouting in vitro by antagonizing Notch signaling pathways in endothelial cells.
16492672 microfibrillar proteins MAGP-1 and MAGP-2 can function outside of their role in elastic fibers to activate a cellular signaling pathway

AA Sequence

MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD      1 - 70
DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC     71 - 140
RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL                                         141 - 173
//

Text Mined References (26)

PMID Year Title
26808411 2016 MAGP2 controls Notch via interactions with RGD binding integrins: Identification of a novel ECM-integrin-Notch signaling axis.
26054006 2015 MFAP5 is related to obesity-associated adipose tissue and extracellular matrix remodeling and inflammation.
25434006 2014 MFAP5 loss-of-function mutations underscore the involvement of matrix alteration in the pathogenesis of familial thoracic aortic aneurysms and dissections.
25277212 2014 Calcium-dependent FAK/CREB/TNNC1 signalling mediates the effect of stromal MFAP5 on ovarian cancer metastatic potential.
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
24496384 2014 Enriched protein screening of human bone marrow mesenchymal stromal cell secretions reveals MFAP5 and PENK as novel IL-10 modulators.
23963447 2013 Microfibril-associated glycoprotein 2 (MAGP2) loss of function has pleiotropic effects in vivo.
23201136 2013 Identification of a functional proprotein convertase cleavage site in microfibril-associated glycoprotein 2.
22885067 2012 NLF2 gene expression in the endometrium of patients with implantation failure after IVF treatment.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
More...