Property Summary

NCBI Gene PubMed Count 35
PubMed Score 12.15
PubTator Score 24.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.134 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.008
diabetes mellitus -1.300 0.001
non primary Sjogren syndrome sicca 1.200 0.028
lung adenocarcinoma 1.011 0.000
ovarian cancer 1.900 0.000

Synonym

Accession Q13347 eIF3i
Symbols TRIP1
EIF3S2
TRIP-1
PRO2242
eIF3-p36
eIF3-beta

Gene

Gene RIF (9)

PMID Text
25609201 Clusterin is an independent predictive factor for prognosis of hepatocellular carcinoma and it facilitates metastasis through EIF3I/Akt/MMP13 signaling.
24056964 eIF3i is a proto-oncogene that drives colon oncogenesis by translationally upregulating COX-2 and activating the beta-catenin signaling pathway
22190034 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit I (EIF3I), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, eukaryotic translation initiation factor 3, subunit I (EIF3I), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22022972 POLR2J interacts with three different subunits of eIF3, eIF3a, eIF3i, and eIF3m.
21378021 findings report that short hairpin RNA mediated depletion of TRIP-1 gene transcripts in A549 cells promotes epithelial-mesenchymal transition (EMT); knockdown of TRIP-1 dramatically increased A549 responsiveness to TGF-beta1 induction of EMT
19329541 TGF-beta receptor interacting protein 1 (TRIP-1), which we show inhibits fibroblast collagen contraction, is higher in fetal than adult fibroblasts
19059401 Subunit b of the eIF3 complex directly binds to HCV IRES domain III via its N-terminal-RRM.
16929481 eIF3i overexpression fosters the integration of growth signals by mTOR into the mRNA translation process, promoting protein synthesis and tumor growth.

AA Sequence

MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTG      1 - 70
SADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDNNEPYM     71 - 140
KIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN    141 - 210
TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGR    211 - 280
VKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA                             281 - 325
//

Text Mined References (43)

PMID Year Title
27462815 2016 eIF3d is an mRNA cap-binding protein that is required for specialized translation initiation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25849773 2015 eIF3 targets cell-proliferation messenger RNAs for translational activation or repression.
25609201 2015 Clusterin facilitates metastasis by EIF3I/Akt/MMP13 signaling in hepatocellular carcinoma.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
24056964 2014 EIF3i promotes colon oncogenesis by regulating COX-2 protein synthesis and ?-catenin activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22022972 2011 A minor isoform of the human RNA polymerase II subunit hRPB11 (POLR2J) interacts with several components of the translation initiation factor eIF3.
21378021 2011 TRIP-1 regulates TGF-?1-induced epithelial-mesenchymal transition of human lung epithelial cell line A549.
21269460 2011 Initial characterization of the human central proteome.
More...