Property Summary

NCBI Gene PubMed Count 34
PubMed Score 62.94
PubTator Score 36.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 5.85520318558943E-8
medulloblastoma, large-cell 6234 1.90767624754095E-6
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.03701947503208E-6
osteosarcoma 7933 4.57342802362397E-6
atypical teratoid / rhabdoid tumor 4369 1.73929410489463E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00117318573033774
glioblastoma 5572 0.00155195071216523
adult high grade glioma 2148 0.00182929159207996
group 3 medulloblastoma 2254 0.0267853349111783
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Ureterocele 10 3.859 1.9

Expression

Synonym

Accession Q13332 O75255 O75870 Q15718 Q16341 Q2M3R7 R-PTP-S
Symbols R-PTP-S
PTPSIGMA
R-PTP-sigma

Gene

PDB

2FH7   2YD2   2YD3   2YD9   4BPC   4PBX  

  Ortholog (8)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 IMPC Term (1)

Gene RIF (18)

PMID Text
26231120 represents an evolutionarily conserved pDC-specific inhibitory receptor, and is required to prevent spontaneous IFN production and immune-mediated intestinal inflammation
25995222 Data demonstrate that synoviocytes are regulated by an RPTPsigma-dependent proteoglycan switch in vivo, which can be targeted for rheumatoid arthritis therapy.
25385546 Receptor protein tyrosine phosphatase sigma (RPTPsigma) regulates neuronal extension and acts as a presynaptic nexus for multiple protein and proteoglycan interactions during synaptogenesis.
22065749 Intragenic microdeletions of the EGFR phosphatase PTPRS were found frequently (26%) in head and neck cancers, identifying this gene as a target of 19p13 loss.
22027896 Structural insights into the homology and differences between mouse protein tyrosine phosphatase-sigma and human protein tyrosine phosphatase-sigma.
21812780 Transgenic zebrafish carrying a promoter-driven expression vector reveal the increased density of olfactory sensory neuron-specific cell synapses.
21454754 crystallographic analyses of a shared HSPG-CSPG binding site reveal a conformational plasticity that can accommodate diverse glycosaminoglycans with comparable affinities; HS and analogs induced RPTPsigma ectodomain oligomerization which was inhibited by CS
21303930 Data show that PTPsigma localizes to PtdIns3P-positive membranes in cells, and this vesicular localization is enhanced during autophagy.
20179269 The receptor protein tyrosine phosphatase sigma (RPTPsigma) has now been identified as a receptor for inhibitory chondroitin sulfate proteoglycans.
20139422 Trans-synaptic adhesions between netrin-G ligand-3 (NGL-3) and receptor tyrosine phosphatases LAR, protein-tyrosine phosphatase delta (PTPdelta), and PTPsigma via specific domains regulate excitatory synapse formation.
More...

AA Sequence

MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKG      1 - 70
KKVNSQRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMG     71 - 140
PQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETD    141 - 210
QGKYECVATNSAGVRYSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQ    211 - 280
GAEDLTPEDDMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITI    281 - 350
TWDSGNPDPVSYYVIEYKSKSQDGPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTR    351 - 420
TGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGS    421 - 490
LLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEARSETSITLSWSPPRQESIIKYELLF    491 - 560
REGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQGLGAFTPVVRQRTLQSKPSAPPQDVKCVSV    561 - 630
RSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIPPTTTQILLEALEKWTQYRITTVAHT    631 - 700
EVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQHGQIRGYQVHYVRMEGAEARG    701 - 770
PPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKVVVTKGAVLGRPTLSV    771 - 840
QQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGATYVFRLAARSR    841 - 910
GGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGALGPARE    911 - 980
TELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSV    981 - 1050
LLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFN   1051 - 1120
LLNGKPSVAPKPDADGFIMVYLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISR   1121 - 1190
LQRRSLRHSRQLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAAS   1191 - 1260
PFSDPFQLDNPDPQPIVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADL   1261 - 1330
APHHPKDPVEMRRINFQTPDSGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESI   1331 - 1400
DPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPE   1401 - 1470
TFGDFWRMVWEQRSATIVMMTRLEEKSRIKCDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNG   1471 - 1540
SSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIK   1541 - 1610
PEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYAYIQKLAQVEPGEHVTGM   1611 - 1680
ELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAY   1681 - 1750
IATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYIL   1751 - 1820
REFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVF   1821 - 1890
ITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHYAT               1891 - 1948
//

Text Mined References (39)

PMID Year Title
26231120 2015 Protein Tyrosine Phosphatase PTPRS Is an Inhibitory Receptor on Human and Murine Plasmacytoid Dendritic Cells.
25995222 2015 Targeting phosphatase-dependent proteoglycan switch for rheumatoid arthritis therapy.
25385546 2014 Structural basis for extracellular cis and trans RPTP? signal competition in synaptogenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22065749 2011 Genomic dissection of the epidermal growth factor receptor (EGFR)/PI3K pathway reveals frequent deletion of the EGFR phosphatase PTPRS in head and neck cancers.
22027896 2011 Structural insights into the homology and differences between mouse protein tyrosine phosphatase-sigma and human protein tyrosine phosphatase-sigma.
21812780 2011 Protein tyrosine phosphatase ? regulates the synapse number of zebrafish olfactory sensory neurons.
21454754 2011 Proteoglycan-specific molecular switch for RPTP? clustering and neuronal extension.
21303930 2011 Identification of PTPsigma as an autophagic phosphatase.
More...