Property Summary

NCBI Gene PubMed Count 72
PubMed Score 107.09
PubTator Score 85.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 4.38802096124716E-7
group 4 medulloblastoma 1875 1.16953956396577E-5
ulcerative colitis 2087 1.70717223032758E-5
atypical teratoid / rhabdoid tumor 4369 1.80287276705441E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.30440942824148E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.02261643739643E-4
osteosarcoma 7933 2.66680281109123E-4
glioblastoma 5572 2.99168849276492E-4
pancreatic carcinoma 567 4.03076733833035E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 5.37544150500792E-4
nasopharyngeal carcinoma 1056 5.58622881949693E-4
pediatric high grade glioma 2712 5.92810425727027E-4
ovarian cancer 8492 7.11450653194645E-4
lung cancer 4473 0.00134406822142623
dermatomyositis 967 0.00154237955869654
pancreatic cancer 2300 0.00407456554558147
primary pancreatic ductal adenocarcinoma 1271 0.0041621721836493
astrocytic glioma 2241 0.00533286935447911
pterygium 74 0.00769468567809314
medulloblastoma, large-cell 6234 0.0174411253061375
esophageal adenocarcinoma 737 0.023848458130587
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Systemic scleroderma 66 0.0 1.0

Expression

Synonym

Accession Q13322 A4D258 A7VJ95 A8K0E6 D3DVM9 O00427 O00701 O75222 Q92606 Q92907 Q92948
Symbols RSS
IRBP
MEG1
GRB-IR
Grb-10

Gene

PDB

1NRV   3HK0  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (27)

PMID Text
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26390806 placental expression associated positively with placental weight, birth weight, and neonatal head circumference
25391383 This study demonstrated that the most significant SNP (rs11770199; p = 0.0003) in single-site analysis was located on chromosome 7 in the GRB10 gene.
25103788 Association of the intronic polymorphism rs12540874 A>G of the GRB10 gene with high birth weight.
24699409 Tissue-specific methylation and possibly imprinting of GRB10 can influence glucose metabolism.
23246379 Grb10 binds to both normal and oncogenic FLT3 and induces PI3K-Akt and STAT5 signaling pathways resulting in an enhanced proliferation, survival and colony formation of hematopoietic cells.
23190452 Studies indicate that insulin receptor (IR) and IGF Type 1 Receptor (IGFR) have been identified as important partners of Grb10/14 and SH2B1/B2 adaptors.
22679513 H19 and GRB10 methylation was normal in Albright's hereditary osteodystrophy patients.
21659604 discovery of Grb10 as an mTORC1 substrate
20174874 Grb10 interacts with Bim L and inhibits its proapoptotic activity in a phosphorylation-dependant manner.
More...

AA Sequence

MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSAC      1 - 70
SMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPN     71 - 140
PFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWT    141 - 210
LVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQL    211 - 280
LQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAG    281 - 350
RKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF    351 - 420
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRT    421 - 490
QHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDG    491 - 560
NTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL                                        561 - 594
//

Text Mined References (78)

PMID Year Title
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26390806 2015 Placental expression of the insulin receptor binding protein GRB10: Relation to human fetoplacental growth and fetal gender.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25391383 2015 Genetic variation in imprinted genes is associated with risk of late-onset Alzheimer's disease.
25223841 2014 A genetic locus in 7p12.2 associated with treatment resistant schizophrenia.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25103788 2014 Association of the intronic polymorphism rs12540874 A>G of the GRB10 gene with high birth weight.
24699409 2014 A central role for GRB10 in regulation of islet function in man.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
23512250 2013 Novel susceptibility variants at 10p12.31-12.2 for childhood acute lymphoblastic leukemia in ethnically diverse populations.
More...