Property Summary

NCBI Gene PubMed Count 76
PubMed Score 110.97
PubTator Score 85.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -1.800 5.3e-03
atypical teratoid / rhabdoid tumor -2.000 1.8e-05
dermatomyositis 2.100 1.5e-03
esophageal adenocarcinoma 1.500 2.4e-02
glioblastoma 1.100 6.9e-04
group 3 medulloblastoma -1.300 1.2e-03
intraductal papillary-mucinous adenoma (... -1.900 5.4e-04
intraductal papillary-mucinous carcinoma... -2.500 3.3e-05
intraductal papillary-mucinous neoplasm ... -2.600 2.0e-04
lung cancer 1.500 1.3e-03
medulloblastoma, large-cell -1.400 1.7e-02
nasopharyngeal carcinoma 1.600 5.6e-04
osteosarcoma -1.279 2.7e-04
ovarian cancer -1.500 7.1e-04
pancreatic cancer 1.200 4.0e-04
pancreatic carcinoma 1.200 4.0e-04
pediatric high grade glioma 1.400 5.9e-04
posterior fossa group A ependymoma -1.200 4.4e-07
primary pancreatic ductal adenocarcinoma -2.778 4.2e-03
pterygium 1.100 7.7e-03
ulcerative colitis 1.300 1.7e-05

Gene RIF (30)

AA Sequence

MALAGCPDSFLHHPYYQDKVEQTPRSQQDPAGPGLPAQSDRLANHQEDDVDLEALVNDMNASLESLYSAC      1 - 70
SMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQRVQRSQPVHILAVRRLQEEDQQFRTSSLPAIPN     71 - 140
PFPELCGPGSPPVLTPGSLPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNSWT    141 - 210
LVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNPMNFFPEQMVTWCQQSNGSQTQL    211 - 280
LQNFLNSSSCPEIQGFLHVKELGKKSWKKLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAG    281 - 350
RKQYNAPTDHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYRIPQQRKALLSPF    351 - 420
STPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRT    421 - 490
QHWFHGRISREESHRIIKQQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLDDG    491 - 560
NTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL                                        561 - 594
//

Text Mined References (82)

PMID Year Title