Tbio | Cyclin-dependent kinase 5 activator 2 |
Activator of CDK5/TPKII.
The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ependymoma | 2514 | 6.36308539856302E-24 |
pilocytic astrocytoma | 3086 | 1.27883054652399E-10 |
atypical teratoid / rhabdoid tumor | 4369 | 8.13017258820013E-8 |
glioblastoma | 5572 | 7.40455168568665E-7 |
adult high grade glioma | 2148 | 1.15646596955953E-5 |
sonic hedgehog group medulloblastoma | 1482 | 2.81230461584496E-4 |
primitive neuroectodermal tumor | 3031 | 3.13463696740208E-4 |
Down syndrome | 548 | 7.42772367258101E-4 |
medulloblastoma, large-cell | 6234 | 9.4846224010292E-4 |
astrocytic glioma | 2241 | 0.00120491787945863 |
oligodendroglioma | 2849 | 0.00498692371788969 |
Disease | log2 FC | p |
---|---|---|
astrocytic glioma | -2.200 | 0.001 |
ependymoma | -3.600 | 0.000 |
oligodendroglioma | -1.700 | 0.005 |
glioblastoma | -3.100 | 0.000 |
sonic hedgehog group medulloblastoma | -1.900 | 0.000 |
atypical teratoid / rhabdoid tumor | -3.100 | 0.000 |
medulloblastoma, large-cell | -1.500 | 0.001 |
primitive neuroectodermal tumor | -2.400 | 0.000 |
adult high grade glioma | -3.000 | 0.000 |
pilocytic astrocytoma | -3.400 | 0.000 |
Down syndrome | -1.300 | 0.001 |
Accession | Q13319 Q4ZFW6 CDK5 activator 2 |
Symbols |
P39 NCK5AI p39nck5ai |
Species | Source |
---|---|
Chimp | OMA EggNOG Inparanoid |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | EggNOG Inparanoid |
PMID | Text |
---|---|
25128817 | p39 is essential for recruiting scaffolding protein muskelin to stress fibers. |
24085300 | Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators. |
20936377 | Hepatocellular carcinoma patients with lower p39 expression had poorer overall survival rate than that with high expression. |
20518484 | both proteasomal degradation and calpain cleavage of p35 and p39 are stimulated by membrane association, which is in turn mediated via myristoylation of their p10 regions. |
19460752 | Knockdown of cyclin-dependent kinase 5, regulatory subunit 2, p39 (CDK5R2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells |
15917097 | role of the CDK5 molecular complex in the genetic etiology of early-onset Alzheimer disease; a yet unknown functional variant in CDK5 or in a nearby gene might lead to increased susceptibility for early-onset Alzheimer disease |
11784720 | Our data suggest that neurotoxic insults lead to calpain-mediated conversion of p39 to p29, which might contribute to deregulation of Cdk5 |
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLV 1 - 70 AASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSG 71 - 140 GSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELV 141 - 210 GWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYP 211 - 280 LKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAA 281 - 350 RDSCAAGTKHWTMNLDR 351 - 367 //
PMID | Year | Title |
---|---|---|
25128817 | 2015 | The Cdk5 activator P39 specifically links muskelin to myosin II and regulates stress fiber formation and actin organization in lens. |
24085300 | 2013 | Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators. |
23251661 | 2012 | Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population. |
20936377 | 2011 | Decreased expression of p39 is associated with a poor prognosis in human hepatocellular carcinoma. |
20518484 | 2010 | Membrane association facilitates degradation and cleavage of the cyclin-dependent kinase 5 activators p35 and p39. |
18507738 | 2008 | Myristoylation of p39 and p35 is a determinant of cytoplasmic or nuclear localization of active cyclin-dependent kinase 5 complexes. |
15917097 | Association of cyclin-dependent kinase 5 and neuronal activators p35 and p39 complex in early-onset Alzheimer's disease. | |
15815621 | 2005 | Generation and annotation of the DNA sequences of human chromosomes 2 and 4. |
12761178 | 2003 | Regulation of type 1 protein phosphatase/inhibitor-2 complex by glycogen synthase kinase-3beta in intact cells. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
More... |