1. Home
  2. Targets
  3. enzyme modulator
  4. kinase modulator
  5. kinase activator
  6. Cyclin-dependent kinase 5 activator 2

Tbio Cyclin-dependent kinase 5 activator 2

Activator of CDK5/TPKII.

The protein encoded by this gene is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
R01 Count 1
Funding $84,807.25
PubMed Score 4.93
PubTator Score 95.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (11)

Disease Z-score Confidence
Down syndrome 548
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
ependymoma 2,514
glioblastoma 5,572
medulloblastoma, large-cell 6,234
oligodendroglioma 2,849
pilocytic astrocytoma 3,086
primitive neuroectodermal tumor 3,031
sonic hedgehog group medulloblastoma 1,482

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.200 0.001
ependymoma -3.600 0.000
oligodendroglioma -1.700 0.005
glioblastoma -3.100 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
medulloblastoma, large-cell -1.500 0.001
primitive neuroectodermal tumor -2.400 0.000
adult high grade glioma -3.000 0.000
pilocytic astrocytoma -3.400 0.000
Down syndrome -1.300 0.001

Synonym

Accession Q13319 Q4ZFW6 CDK5 activator 2
Symbols P39
NCK5AI
p39nck5ai

Gene

CDK5R2

PANTHER Protein Class (3)

 Grant Application (1)

 GO Function (2)

 GO Component (3)

 GO Process (7)

 Compartment GO Term (6)

 MGI Term (8)

Pathway (2)

 UniProt Keyword (8)

Gene RIF (7)

PMID Text
25128817 p39 is essential for recruiting scaffolding protein muskelin to stress fibers.
24085300 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
20936377 Hepatocellular carcinoma patients with lower p39 expression had poorer overall survival rate than that with high expression.
20518484 both proteasomal degradation and calpain cleavage of p35 and p39 are stimulated by membrane association, which is in turn mediated via myristoylation of their p10 regions.
19460752 Knockdown of cyclin-dependent kinase 5, regulatory subunit 2, p39 (CDK5R2) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
15917097 role of the CDK5 molecular complex in the genetic etiology of early-onset Alzheimer disease; a yet unknown functional variant in CDK5 or in a nearby gene might lead to increased susceptibility for early-onset Alzheimer disease
11784720 Our data suggest that neurotoxic insults lead to calpain-mediated conversion of p39 to p29, which might contribute to deregulation of Cdk5

AA Sequence 

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLV      1 - 70
AASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSG     71 - 140
GSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELV    141 - 210
GWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYP    211 - 280
LKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAA    281 - 350
RDSCAAGTKHWTMNLDR                                                         351 - 367
//

Text Mined References (17)

PMID Year Title
25128817 2015 The Cdk5 activator P39 specifically links muskelin to myosin II and regulates stress fiber formation and actin organization in lens.
24085300 2013 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20936377 2011 Decreased expression of p39 is associated with a poor prognosis in human hepatocellular carcinoma.
20518484 2010 Membrane association facilitates degradation and cleavage of the cyclin-dependent kinase 5 activators p35 and p39.
18507738 2008 Myristoylation of p39 and p35 is a determinant of cytoplasmic or nuclear localization of active cyclin-dependent kinase 5 complexes.
15917097 Association of cyclin-dependent kinase 5 and neuronal activators p35 and p39 complex in early-onset Alzheimer's disease.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12761178 2003 Regulation of type 1 protein phosphatase/inhibitor-2 complex by glycogen synthase kinase-3beta in intact cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...