Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.03
PubTator Score 95.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -3.000 1.2e-05
astrocytic glioma -2.200 1.2e-03
Astrocytoma, Pilocytic -3.400 1.2e-10
atypical teratoid / rhabdoid tumor -3.100 8.1e-08
Down syndrome -1.300 7.4e-04
ependymoma -2.700 2.5e-03
glioblastoma -2.800 1.6e-11
group 4 medulloblastoma -1.300 7.5e-03
medulloblastoma, large-cell -1.500 9.5e-04
oligodendroglioma -1.700 5.0e-03
primitive neuroectodermal tumor -2.400 3.1e-04

Gene RIF (7)

AA Sequence

MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLV      1 - 70
AASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSG     71 - 140
GSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELV    141 - 210
GWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYP    211 - 280
LKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAA    281 - 350
RDSCAAGTKHWTMNLDR                                                         351 - 367
//

Text Mined References (18)

PMID Year Title