Property Summary

NCBI Gene PubMed Count 44
Grant Count 33
R01 Count 24
Funding $3,972,542.09
PubMed Score 269.34
PubTator Score 123.98

Knowledge Summary

Patent (18,315)

Expression

  Differential Expression (11)

Pathway (1)

Gene RIF (28)

PMID Text
26549850 PTK7 enriches in self-renewing, multipotent stem cells of the human colon.
26368655 findings implicate PTK7 as a risk factor for NTDs and provide additional evidence for a pathogenic role of PCP signaling in these malformations
25986862 data demonstrates that PTK7 regulates the activity of KDR biphasically by inducing oligomerization of KDR molecules at lower concentrations and by surrounding KDR molecules at higher concentrations.
25962058 overexpression in PTK7-negative cancer cells led to increased metastatic events. PTK7 expression thus represents a potential prognostic biomarker and a novel therapeutic target in CRC.
25796105 PTK7 acts as a cancer-related gene and may be a potent prognostic marker for Hepatocellular carcinoma(HCC).
25550828 Expression level of PTK7 was significantly decreased from benign to malignant ovarian epithelial tumors. survival analysis showed that patients with negative expression of PTK7 protein had poorer outcome than those with positive expression.
25204555 PTK7 regulates Id1 expression in CD44-high glioma cell lines. Targeting PTK7 could be an effective strategy for treating glioma with high CD44 expression.
25006253 results provide convincing evidence that both PTK7 expression and proteolysis, rather than the level of the cellular full-length PTK7 alone, contribute to efficient directional cell motility and metastasis in cancer
24789704 Furthermore, we confirmed that these phenotypic changes are associated with the inactivation of AKT and ERK. Our findings suggest that PTK7 has different oncogenic roles in organs and target tumors.
24741114 The results suggest that N-acylethanolamine acid amidase and protein tyrosine kinase 7 may be used as potential tissue biomarkers to avoid overtreatment of non-aggressive prostate cancer
More...

AA Sequence

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA      1 - 70
PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI     71 - 140
QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC    141 - 210
SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV    211 - 280
FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP    281 - 350
EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD    351 - 420
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSI    421 - 490
EAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARV    491 - 560
TRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPKPLIQWKGKDR    561 - 630
ILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYK    631 - 700
MIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALT    701 - 770
SLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ    771 - 840
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVAL    841 - 910
CTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILE    911 - 980
GDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLMQRCWALSPKD    981 - 1050
RPSFSEIASALGDSTVDSKP                                                     1051 - 1070
//

Text Mined References (50)

PMID Year Title
26549850 2015 Isolation of Human Colon Stem Cells Using Surface Expression of PTK7.
26368655 2015 Role of the planar cell polarity gene Protein tyrosine kinase 7 in neural tube defects in humans.
25986862 2015 Biphasic effect of PTK7 on KDR activity in endothelial cells and angiogenesis.
25962058 2015 Overexpression of the Promigratory and Prometastatic PTK7 Receptor Is Associated with an Adverse Clinical Outcome in Colorectal Cancer.
25796105 2015 Protein tyrosine kinase 7: a hepatocellular carcinoma-related gene detected by triple-combination array.
25550828 2014 PTK7 protein is decreased in epithelial ovarian carcinomas with poor prognosis.
25204555 2015 PTK7 regulates Id1 expression in CD44-high glioma cells.
25006253 2014 Protein-tyrosine pseudokinase 7 (PTK7) directs cancer cell motility and metastasis.
24789704 2014 Protein tyrosine kinase 7 plays a tumor suppressor role by inhibiting ERK and AKT phosphorylation in lung cancer.
24741114 2014 Glycoproteomic analysis of prostate cancer tissues by SWATH mass spectrometry discovers N-acylethanolamine acid amidase and protein tyrosine kinase 7 as signatures for tumor aggressiveness.
More...