Property Summary

NCBI Gene PubMed Count 125
Grant Count 77
R01 Count 40
Funding $7,726,851.79
PubMed Score 73.77
PubTator Score 158.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Cancer 2,346 3.167 1.6
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus -1.100 0.003

Synonym

Accession Q13263 O00677 Q7Z632 Q93040 Q96IM1 TIF1-beta
Symbols KAP1
TF1B
RNF96
TIF1B
PPP1R157

Gene

PANTHER Protein Class (2)

PDB

1FP0   2RO1   2YVR  

Gene RIF (85)

PMID Text
26824653 Adipose tissue transcriptome analyses in children indicate that humans, like mice cluster into distinct sub-populations, stratifying according to Trim28 expression, transcriptome organization, and obesity-associated imprinted gene dysregulation.
26725010 KAP1 controls 7SK snRNP delivery to promoter-proximal regions to facilitate "on-site" P-TEFb activation and Pol II elongation.
26537675 KAP1 binds to the viral E1B-55K protein, promoting its SUMO modification, therefore illustrating a crucial step for efficient viral replication.
26476730 These results indicate that over-expression of TRIM28 is associated with poor outcome in glioma patients.
26293668 Study indicates that TRIM28 appears to play a unique and essential role in transcriptional elongation and DNA repair by pausing and stabilizing Pol II. [Review]
26081272 successfully established stable pcDNA5/FRT/TO-KAP1-HEK293 cell line, which can express KAP1 inducibly. This inducible cell line might be very useful for KAP1 functional studies.
26055329 TRIM28 is an E3 ligase for ARF-mediated SUMOylation of NPM1.
25995248 Nrf2 interaction with KSHV LANA-1 and the host KAP1 repress viral lytic gene expression.
25960296 Identify a nuclear localization signal within the 462-494 amino acid region of TRIM28 that overlaps with its HP1 binding site. GST-pulldown experiments revealed the interaction of the arginine-rich TRIM28 NLS with various importin alpha subtypes.
25948750 Inhibition of LMP1-induced protein sumoylation abrogates the binding of KAP1 to Epstein-Barr Virus promoters.
More...

AA Sequence

MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALELLEHCGVCRE      1 - 70
RLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVCKQQCFSKDIVENYFMRDSGS     71 - 140
KAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEAHQRVKYTKDHTVRSTGPAKSRDGERTVYCN    141 - 210
VHKHEPLVLFCESCDTLTCRDCQLNAHKDHQYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSS    211 - 280
IRQVSDVQKRVQVDVKMAILQIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFAS    281 - 350
WALESDNNTALLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP    351 - 420
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSL    421 - 490
ERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAGTPGAPPLAGMAIVKEEETEA    491 - 560
AIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTSSGLEVVAPEGTSAPGGGPGTLDDSATICRV    561 - 630
CQKPGDLVMCNQCEFCFHLDCHLPALQDVPGEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPAN    631 - 700
QRKCERVLLALFCHEPCRPLHQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFK    701 - 770
QFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP         771 - 835
//

Text Mined References (151)

PMID Year Title
27029610 2016 ATRX binds to atypical chromatin domains at the 3' exons of zinc finger genes to preserve H3K9me3 enrichment.
26824653 2016 Trim28 Haploinsufficiency Triggers Bi-stable Epigenetic Obesity.
26725010 2016 KAP1 Recruitment of the 7SK snRNP Complex to Promoters Enables Transcription Elongation by RNA Polymerase II.
26537675 2015 KAP1 Is a Host Restriction Factor That Promotes Human Adenovirus E1B-55K SUMO Modification.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26476730 2016 TRIM28 as an independent prognostic marker plays critical roles in glioma progression.
26293668 2015 TRIM28 as a novel transcriptional elongation factor.
26081272 2015 Establishment of stable cell line for inducing KAP1 protein expression.
26055329 2015 TRIM28 Is an E3 Ligase for ARF-Mediated NPM1/B23 SUMOylation That Represses Centrosome Amplification.
25995248 2015 Activated Nrf2 Interacts with Kaposi's Sarcoma-Associated Herpesvirus Latency Protein LANA-1 and Host Protein KAP1 To Mediate Global Lytic Gene Repression.
More...