Property Summary

NCBI Gene PubMed Count 51
PubMed Score 191.49
PubTator Score 54.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.700 3.8e-05
osteosarcoma -1.449 9.4e-06
ovarian cancer -2.300 6.8e-11
Pick disease -2.100 1.0e-06
progressive supranuclear palsy -1.600 6.8e-03
Waldenstrons macroglobulinemia 1.012 2.1e-02

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHA      1 - 70
RGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYAD     71 - 140
AHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRR    141 - 210
SSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRS    211 - 280
PKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD          281 - 344
//

Text Mined References (60)

PMID Year Title