Property Summary

NCBI Gene PubMed Count 49
Grant Count 17
R01 Count 15
Funding $2,252,305.28
PubMed Score 186.42
PubTator Score 54.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.012 0.021
osteosarcoma -1.449 0.000
group 3 medulloblastoma 1.700 0.000
Pick disease -2.100 0.000
progressive supranuclear palsy -1.600 0.007
ovarian cancer -2.300 0.000

Gene RIF (24)

PMID Text
25889056 The authors propose that splicing at 3'ss A3 is dependent on binding of the enhancing SR proteins SRSF2 and SRSF6 to the HIV-1 tat ESE and ESE2 sequence.
25889056 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
25889056 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
25889056 SRSF6 expression inhibits inclusion of exons 4cab and 5 into viral Rev and Nef-mRNAs by shifting a viral splice acceptor selection from 3'ss A5 to 3'ss A3 usage, leading to decreased levels of Rev and Nef proteins
24440982 SRSF6 is a regulator of wound healing and tissue homeostasis in skin.
23648111 Zinc inhibits the activity of SRSF6 and promotes elimination of exon 4, leading to preferential generation of BimS.
23132731 The splicing factor SRSF6 is an oncoprotein that regulates the proliferation and survival of lung and colon cancer cells.
22767602 Phosphorylation of SRp55 by Dyrk1A suppressed its ability to promote Tau exon 10 inclusion.
22516966 Report upregulation of Bim and the splicing factor SRp55 in melanoma cells from patients treated with selective BRAF inhibitors.
21345357 SRp55 aids in the generation of partially spliced and unspliced HIV-1 mRNAs.
More...

AA Sequence

MPRVYIGRLSYNVREKDIQRFFSGYGRLLEVDLKNGYGFVEFEDSRDADDAVYELNGKELCGERVIVEHA      1 - 70
RGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYAD     71 - 140
AHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRR    141 - 210
SSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDEYEKSRSRSRSRS    211 - 280
PKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRSRSSSRD          281 - 344
//

Text Mined References (57)

PMID Year Title
25889056 2015 Balanced splicing at the Tat-specific HIV-1 3'ss A3 is critical for HIV-1 replication.
25416956 2014 A proteome-scale map of the human interactome network.
24440982 2014 Splicing factor SRSF6 promotes hyperplasia of sensitized skin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23648111 2013 Zinc-induced modulation of SRSF6 activity alters Bim splicing to promote generation of the most potent apoptotic isoform BimS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23132731 2013 The splicing factor SRSF6 is amplified and is an oncoprotein in lung and colon cancers.
22767602 2012 Dual-specificity tyrosine phosphorylation-regulated kinase 1A (Dyrk1A) modulates serine/arginine-rich protein 55 (SRp55)-promoted Tau exon 10 inclusion.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...