Property Summary

NCBI Gene PubMed Count 17
PubMed Score 55.51
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis 2010 5.4e-07
ovarian cancer 8519 2.3e-06
psoriasis 6694 1.3e-04
medulloblastoma, large-cell 6241 5.9e-03

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.100 5.9e-03
ovarian cancer 2.100 2.3e-06
psoriasis 1.800 1.3e-04
tuberculosis 1.200 5.4e-07

Protein-protein Interaction (12)

Gene RIF (4)

AA Sequence

MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYA      1 - 70
ELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSV     71 - 140
ESARREIALWFRADELLCWEDSAGHWLYE                                             141 - 169
//

Text Mined References (18)

PMID Year Title