Property Summary

NCBI Gene PubMed Count 16
PubMed Score 55.35
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.800 0.000
medulloblastoma, large-cell -1.100 0.006
tuberculosis 1.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q13232 Q9BWH4 NDK 3
Symbols NDPKC
NDPK-C
NM23H3
DR-nm23
NM23-H3
c371H6.2

Gene

PDB

1ZS6  

Gene RIF (3)

PMID Text
23765094 Down-regulated DR-nm23 expression is associated with invasion and metastasis in colorectal cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17900511 Among genes correlated to nodal metastatic progression, we verified in vitro that NM23-H3 reduced cell motility.

AA Sequence

MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYA      1 - 70
ELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSV     71 - 140
ESARREIALWFRADELLCWEDSAGHWLYE                                             141 - 169
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23765094 2013 Inhibitory effect of upregulated DR-nm23 expression on invasion and metastasis in colorectal cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
17900511 2007 Molecular classification of nodal metastasis in primary larynx squamous cell carcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...