Property Summary

NCBI Gene PubMed Count 16
PubMed Score 55.35
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
tuberculosis 1563 5.4262661230818E-7
ovarian cancer 8492 2.29244637730154E-6
psoriasis 6685 1.30606828557576E-4
medulloblastoma, large-cell 6234 0.00592613352816083

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.800 0.000
medulloblastoma, large-cell -1.100 0.006
tuberculosis 1.200 0.000
ovarian cancer 2.100 0.000

Synonym

Accession Q13232 Q9BWH4 NDK 3
Symbols NDPKC
NDPK-C
NM23H3
DR-nm23
NM23-H3
c371H6.2

Gene

PDB

1ZS6  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (3)

PMID Text
23765094 Down-regulated DR-nm23 expression is associated with invasion and metastasis in colorectal cancer.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17900511 Among genes correlated to nodal metastatic progression, we verified in vitro that NM23-H3 reduced cell motility.

AA Sequence

MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYA      1 - 70
ELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSV     71 - 140
ESARREIALWFRADELLCWEDSAGHWLYE                                             141 - 169
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23765094 2013 Inhibitory effect of upregulated DR-nm23 expression on invasion and metastasis in colorectal cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19852809 2009 Nme protein family evolutionary history, a vertebrate perspective.
17900511 2007 Molecular classification of nodal metastasis in primary larynx squamous cell carcinoma.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16537434 2006 p90 ribosomal S6 kinase 2 exerts a tonic brake on G protein-coupled receptor signaling.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...