Property Summary

NCBI Gene PubMed Count 198
Grant Count 47
R01 Count 33
Funding $3,756,882.18
PubMed Score 1275.19
PubTator Score 1178.03

Knowledge Summary

Patent

No data available

Expression

Gene RIF (164)

PMID Text
27125092 PAPP-A determination during the first trimester of pregnancy in women at risk for IUGR makes possible the prophylactic treatment and monitoring of pregnancy.
26823756 miR-141 may play important roles in ox-LDL-induced abnormal proliferation of the vascular smooth muscle cells by targeting PAPPA.
26697810 The first trimester maternal PAPP-A levels were decreased in the ICSI group compared with those in the controls, but not in IVF and embryo transfer groups.
26362726 The performance of screening for GDM by maternal factors was not improved by the addition of PAPP-A and/or PLGF. First trimester maternal serum PAPP-A and PLGF are not useful in screening for GDM.
26336825 PAPP-A in ascites and tissue-associated PAPP-A serve to increase IGF bioactivity and, thereby, to stimulate IGF-IR-mediated ovarian tumor growth.
26297643 Suggest that PAPP-A is specifically involved in the regulation of steroidogenesis in human antral follicles.
26223809 Data indicate that rising pregnancy-associated plasma protein-A (PAPP-A) levels are prognostic in patients with coronary artery disease (CAD).
26214492 The study findings showed that plasma sCD40L, fetuin-A, and PAPP-A levels are associated with carotid plaque formation and instability.
26122709 The A>C variation of rs7020782 of PAPPA might be an independent risk factor for carotid plaque development and calcification.
26020769 PAPPA has a role in progression of liver cancer and is a novel paracrine inducer of the pro-tumorigenic NFkappaB signaling pathway
More...

AA Sequence

MRLWSWVLHLGLLSAALGCGLAERPRRARRDPRAGRPPRPAAGPATCATRAARGRRASPPPPPPPGGAWE      1 - 70
AVRVPRRRQQREARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGL     71 - 140
YDKCSYISRDRGWVVGIHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLAATYDGQFMKL    141 - 210
YVNGAQVATSGEQVGGIFSPLTQKCKVLMLGGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTA    211 - 280
LPQLLLQENWDNVKHAWSPMKDGSSPKVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQP    281 - 350
KVVRYRVVNLYEDDHKNPTVTREQVDFQHHQLAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIG    351 - 420
DENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGVCDMDCNYERFNFDGGECCDPEITNVTQTCFDPDS    421 - 490
PHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATWPWDKEALMHLGGIVLNPSFYGMPGHTHTM    491 - 560
IHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPAPKHKSCGDPGPGNDTCGFHSFFNT    561 - 630
PYNNFMSYADDDCTDSFTPNQVARMHCYLDLVYQGWQPSRKPAPVALAPQVLGHTTDSVTLEWFPPIDGH    631 - 700
FFERELGSACHLCLEGRILVQYASNASSPMPCSPSGHWSPREAEGHPDVEQPCKSSVRTWSPNSAVNPHT    701 - 770
VPPACPEPQGCYLELEFLYPLVPESLTIWVTFVSTDWDSSGAVNDIKLLAVSGKNISLGPQNVFCDVPLT    771 - 840
IRLWDVGEEVYGIQIYTLDEHLEIDAAMLTSTADTPLCLQCKPLKYKVVRDPPLQMDVASILHLNRKFVD    841 - 910
MDLNLGSVYQYWVITISGTEESEPSPAVTYIHGSGYCGDGIIQKDQGEQCDDMNKINGDGCSLFCRQEVS    911 - 980
FNCIDEPSRCYFHDGDGVCEEFEQKTSIKDCGVYTPQGFLDQWASNASVSHQDQQCPGWVIIGQPAASQV    981 - 1050
CRTKVIDLSEGISQHAWYPCTISYPYSQLAQTTFWLRAYFSQPMVAAAVIVHLVTDGTYYGDQKQETISV   1051 - 1120
QLLDTKDQSHDLGLHVLSCRNNPLIIPVVHDLSQPFYHSQAVRVSFSSPLVAISGVALRSFDNFDPVTLS   1121 - 1190
SCQRGETYSPAEQSCVHFACEKTDCPELAVENASLNCSSSDRYHGAQCTVSCRTGYVLQIRRDDELIKSQ   1191 - 1260
TGPSVTVTCTEGKWNKQVACEPVDCSIPDHHQVYAASFSCPEGTTFGSQCSFQCRHPAQLKGNNSLLTCM   1261 - 1330
EDGLWSFPEALCELMCLAPPPVPNADLQTARCRENKHKVGSFCKYKCKPGYHVPGSSRKSKKRAFKTQCT   1331 - 1400
QDGSWQEGACVPVTCDPPPPKFHGLYQCTNGFQFNSECRIKCEDSDASQGLGSNVIHCRKDGTWNGSFHV   1401 - 1470
CQEMQGQCSVPNELNSNLKLQCPDGYAIGSECATSCLDHNSESIILPMNVTVRDIPHWLNPTRVERVVCT   1471 - 1540
AGLKWYPHPALIHCVKGCEPFMGDNYCDAINNRAFCNYDGGDCCTSTVKTKKVTPFPMSCDLQGDCACRD   1541 - 1610
PQAQEHSRKDLRGYSHG                                                        1611 - 1627
//

Text Mined References (199)

PMID Year Title
27125092 INTRAUTERINE GROWTH RESTRICTION--PREDICTIVE SERUM MARKERS.
26823756 2015 MicroRNA-141 inhibits vascular smooth muscle cell proliferation through targeting PAPP-A.
26697810 2016 First-trimester maternal serum ADAM12-s and PAPP-A levels are altered in pregnancies conceived after assisted reproduction techniques (ART).
26362726 2015 First-trimester biochemical markers of placentation in screening for gestational diabetes mellitus.
26336825 2015 PAPP-A proteolytic activity enhances IGF bioactivity in ascites from women with ovarian carcinoma.
26297643 2015 Pregnancy-associated plasma protein A in human ovarian follicles and its association with intrafollicular hormone levels.
26223809 2015 The utility of pregnancy-associated plasma protein A for determination of prognosis in a cohort of patients with coronary artery disease.
26214492 2015 Correlation of plasma soluble cluster of differentiation 40 ligand, alpha fetoprotein A, and pregnancy-associated plasma protein A with carotid plaque in patients with ischemic stroke.
26122709 2015 Correlation of single nucleotide polymorphisms in the pregnancy-associated plasma protein-A gene with carotid plaques.
26020769 2015 Causal Modeling of Cancer-Stromal Communication Identifies PAPPA as a Novel Stroma-Secreted Factor Activating NF?B Signaling in Hepatocellular Carcinoma.
More...