Property Summary

NCBI Gene PubMed Count 33
PubMed Score 0.00
PubTator Score 62.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
25961819 Aberrant expression and methylation of SEMA3B could be suggested as markers of lung and renal cancer progression.
25454475 SEMA3B mRNA and protein is not altered in severe early onset preeclamptic placentas.
25335892 although plexin-A4 overexpression restored Sema3A signaling in plexin-A1-silenced cells, it failed to restore Sema3B signaling in plexin-A2-silenced cells.
24402303 CpG methylation of SEMA3B epigenetically regulates SEMA3B expression during development of gastric cancer.
24280143 The transcriptional activity of RHOA, SEMA3B, and CKAP2 genes was assessed in blood samples of leukaemia patients and healthy donors.
23906303 Loss of Sema3B expression is associated with biochemical recurrence of patients with low- and intermediate-risk prostate cancer.
23292452 Three candidate tumor-suppressor genes, SEMA3B, AXUD1 and GNAT1 may be involved in oral squamous cell carcinoma.
20124444 semaphorin-3B and semaphorin-3F have roles in ovarian cancer
20088387 that methylation of promoter CpG-island contributed into inactivation of SEMA3B gene-suppressor in RCC.
19683737 These data indicate that polymorphisms in SEMA3B are associated with prostate cancer risk and poor prognosis in Hispanic and nonHispanic white men
More...

AA Sequence

MGRAGAAAVIPGLALLWAVGLGSAAPSPPRLRLSFQELQAWHGLQTFSLERTCCYQALLVDEERGRLFVG      1 - 70
AENHVASLNLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHAYNRTHLLACGTGAFHPTC     71 - 140
AFVEVGHRAEEPVLRLDPGRIEDGKGKSPYDPRHRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSL    141 - 210
RTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLV    211 - 280
NKWTTFLKARLVCSVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSSIFQGSAVCVYSMNDVRRA    281 - 350
FLGPFAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLPTGGRPL    351 - 420
FLQVGANYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISVPKGSRPSAEGLLLEELHVFEDSAAVTS    421 - 490
MQISSKRHQLYVASRSAVAQIALHRCAAHGRVCTECCLARDPYCAWDGVACTRFQPSAKRRFRRQDVRNG    491 - 560
DPSTLCSGDSSRPALLEHKVFGVEGSSAFLECEPRSLQARVEWTFQRAGVTAHTQVLAEERTERTARGLL    561 - 630
LRRLRRRDSGVYLCAAVEQGFTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGG    631 - 700
GGSANSLRMCRPQPALQSLPLESRRKGRNRRTHAPEPRAERGPRSATHW                         701 - 749
//

Text Mined References (34)

PMID Year Title
25961819 2015 Tumor Suppressor Function of the SEMA3B Gene in Human Lung and Renal Cancers.
25454475 2014 Placental SEMA3B expression is not altered in severe early onset preeclampsia.
25335892 2014 The role of the plexin-A2 receptor in Sema3A and Sema3B signal transduction.
24402303 2014 Analysis of SEMA3B methylation and expression patterns in gastric cancer tissue and cell lines.
24280143 2013 RHOA, SEMA3B, and CKAP2 expression in leukaemia of different types: the results of a pilot experiment.
23906303 2013 The predictive value of semaphorins 3 expression in biopsies for biochemical recurrence of patients with low- and intermediate-risk prostate cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23292452 2013 Screening of candidate tumor-suppressor genes in 3p21.3 and investigation of the methylation of gene promoters in oral squamous cell carcinoma.
20124444 2010 Hormonal regulation and distinct functions of semaphorin-3B and semaphorin-3F in ovarian cancer.
20088387 [Two CpG-islands of SEMA3B gene: methylation in clear cell renal cell carcinoma].
More...