Property Summary

NCBI Gene PubMed Count 36
PubMed Score 8.73
PubTator Score 50.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma 1.300 0.000
Breast cancer 1.100 0.000

Synonym

Accession Q13112 Q99548 CAF-1 subunit B
Symbols CAF1
MPP7
CAF-1
CAF1A
CAF1P60
CAF-IP60
MPHOSPH7

Gene

Gene RIF (11)

PMID Text
24039914 The levels of the EDNRB, HJURP and p60/CAF-1 proteins were strongly associated with overall survival in high-grade gliomas patients (p<0.001, p<0.001 and p=0.002, respectively), whereas the one of PDLI4 was not (P=0.11).
23109837 All the evaluated malignant tumors showed CAF-1 p60 overexpression, confirming the emerging role of CAF-1 p60 as a new proliferation and prognostic marker for cancer.
21109952 Overexpression of CAF-1/p60, on histological and/or cytological samples, characterizes malignant salivary gland tumours with aggressive behaviour
21083601 CAF-1 is a proliferation marker in various malignant tumours with prognostic value in renal, endometrial and cervical carcinomas, which supports the value of CAF-1 as a clinical marker of cancer progression.
20178651 Chromatin Assembly Factor-1/p60 may have a role in progression and metastasis of melanoma
19498464 The histone H3K9 methyltransferase SetDB1 associates with the specific heterochromatin protein 1alpha (HP1alpha)-chromatin assembly factor 1 (CAF1) chaperone complex.
19309489 overexpression of CAF-1/p60 characterized prostatic cancers with a worse prognosis
16980972 The N- & C-terminal regions of ASF1a and ASF1b determine the different affinities of these two proteins for HIRA, by contacting regions outside the HIRA B domain. CAF-1 p60 also uses B domain-like motifs for binding to ASF1a, thereby competing with HIRA.
15068244 Downregulated protein level of CAF-1 p60 in adult brain of patients with Down syndrome (DS) in contrast to Alzheimer's disease indicates that it can be considered specific for changes in DS.
15024074 These data identify chromatin assembly factor 1 as an essential factor not only for S-phase-specific chromatin assembly but also for proliferating cell viability.
More...

AA Sequence

MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPDGKAIVEFLSNLARHTKAVN      1 - 70
VVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATD     71 - 140
GNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVS    141 - 210
KMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAH    211 - 280
LPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLS    281 - 350
DISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTP    351 - 420
ASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQ    421 - 490
AWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP     491 - 559
//

Text Mined References (46)

PMID Year Title
24039914 2013 Prognostic significance of EDN/RB, HJURP, p60/CAF-1 and PDLI4, four new markers in high-grade gliomas.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23109837 2012 Tissue microarray-based evaluation of Chromatin Assembly Factor-1 (CAF-1)/p60 as tumour prognostic marker.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21109952 2011 The proliferation marker Chromatin Assembly Factor-1 is of clinical value in predicting the biological behaviour of salivary gland tumours.
21083601 2010 Clinical significance and prognostic value of chromatin assembly factor-1 overexpression in human solid tumours.
20178651 2010 Overexpression of Chromatin Assembly Factor-1/p60 helps to predict the prognosis of melanoma patients.
More...