Property Summary

NCBI Gene PubMed Count 37
PubMed Score 9.99
PubTator Score 50.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Mouth Diseases 12 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 8.2e-08
Breast cancer 3578 2.5e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Globe disease 67 0.0 1.4
Nephrolithiasis 56 0.0 1.6
Disease Target Count Z-score Confidence
Down syndrome 499 3.685 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 2.5e-05
lung adenocarcinoma 1.300 8.2e-08

Gene RIF (11)

AA Sequence

MKVITCEIAWHNKEPVYSLDFQHGTAGRIHRLASAGVDTNVRIWKVEKGPDGKAIVEFLSNLARHTKAVN      1 - 70
VVRFSPTGEILASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLNKENWTVVKTLRGHLEDVYDICWATD     71 - 140
GNLMASASVDNTAIIWDVSKGQKISIFNEHKSYVQGVTWDPLGQYVATLSCDRVLRVYSIQKKRVAFNVS    141 - 210
KMLSGIGAEGEARSYRMFHDDSMKSFFRRLSFTPDGSLLLTPAGCVESGENVMNTTYVFSRKNLKRPIAH    211 - 280
LPCPGKATLAVRCCPVYFELRPVVETGVELMSLPYRLVFAVASEDSVLLYDTQQSFPFGYVSNIHYHTLS    281 - 350
DISWSSDGAFLAISSTDGYCSFVTFEKDELGIPLKEKPVLNMRTPDTAKKTKSQTHRGSSPGPRPVEGTP    351 - 420
ASRTQDPSSPGTTPPQARQAPAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQ    421 - 490
AWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP     491 - 559
//

Text Mined References (47)

PMID Year Title