Property Summary

NCBI Gene PubMed Count 61
PubMed Score 43.25
PubTator Score 376.74

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 1.11760281794723E-10
pilocytic astrocytoma 3086 1.56606228583019E-7
atypical teratoid / rhabdoid tumor 4369 1.62919246254232E-6
pediatric high grade glioma 2712 9.34418699534254E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.08693600140943E-4
group 4 medulloblastoma 1875 3.39384196701861E-4
glioblastoma 5572 0.00110149634777537
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00190537905320533
primary pancreatic ductal adenocarcinoma 1271 0.00408546306023356
pancreatic cancer 2300 0.00497356781698498
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0118701918125885
gastric carcinoma 832 0.0135300955842033
astrocytoma 1493 0.0165994432649486
subependymal giant cell astrocytoma 2287 0.0258027525047088
Disease Target Count Z-score Confidence
Congenital heart disease 63 3.041 1.5



Accession Q13087 A6ZJ64 B4DI27 Q2WGM4 Q4TT67 Q6B010 Q96KJ6 Q9BW95
Symbols PDI


  Ortholog (5)

Gene RIF (66)

25664880 It was found that PDI interacts with dengue virus nonstructural protein 1 (NS1) intracellularly as well as on the surface in the lipid raft domain.
25631539 Tissue factor-regulated vascular smooth cell migration and microvessel formation is under the control of the ER-protein PDIA2.
25419565 Data show that cell surface disulfide isomerase (PDI) expression and function regulate the capacity of natriuretic peptides to generate cyclic guanosine monophosphate (cGMP) through interaction with their receptors.
25122773 These results indicate that BPA, a widely distributed and potentially harmful chemical, inhibits Ero1-PDI-mediated disulfide bond formation.
24967714 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
24415753 PDI appears to regulate cytoskeletal reorganization by the thiol-disulfide exchange in beta-actin via a redox-dependent mechanism.
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23454490 GPx7 is an unusual CysGPx catalyzing the peroxidatic cycle by a one Cys mechanism in which GSH and PDI are alternative substrates.
23206338 HIV-1 gp120 co-localizes with the endoplasmic reticulum protein PDI in HIV-transfected 293T cells
23167757 Human major histocompatibility complex class 1 antigens (HLA-A,B,C) are potential binding partners of PDIA2, suggesting an involvement for PDIA2 in antigen presentation.

AA Sequence

LDNGGVLPTEEPPEEPAAPFPEPPANSTMGSKEEL                                       491 - 525

Text Mined References (65)

PMID Year Title
25664880 2015 Protein disulfide isomerase mediates dengue virus entry in association with lipid rafts.
25631539 2015 Protein disulphide-isomerase A2 regulated intracellular tissue factor mobilisation in migrating human vascular smooth muscle cells.
25419565 2014 Cell surface protein disulfide isomerase regulates natriuretic peptide generation of cyclic guanosine monophosphate.
25122773 2014 Inhibition of the functional interplay between endoplasmic reticulum (ER) oxidoreduclin-1? (Ero1?) and protein-disulfide isomerase (PDI) by the endocrine disruptor bisphenol A.
24415753 2014 Protein disulfide isomerase directly interacts with ?-actin Cys374 and regulates cytoskeleton reorganization.
23979138 2013 Dynamic regulation of Ero1? and peroxiredoxin 4 localization in the secretory pathway.
23454490 2013 Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.
23167757 2013 N-linked glycosylation modulates dimerization of protein disulfide isomerase family A member 2 (PDIA2).
22773830 2012 Protein disulfide isomerase is required for platelet-derived growth factor-induced vascular smooth muscle cell migration, Nox1 NADPH oxidase expression, and RhoGTPase activation.
22685557 2012 Protein disulfide isomerase regulates endoplasmic reticulum stress and the apoptotic process during prion infection and PrP mutant-induced cytotoxicity.