Property Summary

NCBI Gene PubMed Count 49
Grant Count 23
R01 Count 22
Funding $3,252,694.58
PubMed Score 183.89
PubTator Score 143.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
pancreatic cancer 1.500 0.001
malignant mesothelioma 2.200 0.000
astrocytic glioma 1.400 0.045
oligodendroglioma 1.100 0.002
group 3 medulloblastoma 1.400 0.033
medulloblastoma, large-cell -1.200 0.024
tuberculosis 1.700 0.000
pancreatic carcinoma 1.500 0.001
subependymal giant cell astrocytoma 1.188 0.024
ovarian cancer -1.600 0.000

Gene RIF (40)

PMID Text
26347229 NAIP and survivin expressions were significantly reduced following varicocele induction when compared to sham animals whereas PDRN-treated rats showed an increase in NAIP and survivin levels.
26109648 human Naip functions to activate the inflammasome in response to flagellin, similar to murine Naip5/6.
25888055 The copy numbers and gene structures of NAIP genes were different in Chinese spinal muscular atrophy patients and healthy controls
25330799 results revealed that SMN2 and NAIP copy numbers significantly influenced the age at onset, risk of death, and life expectancy in the spinal muscular atrophy patients and that the effect of SMN2 was more significant
25137037 Modulation of chemotherapeutic drug resistance in neuroblastoma SK-N-AS cells by the neural apoptosis inhibitory protein and miR-520f.
24711022 Copy number variations of SMN2 and NAIP genes in patients are related to spinal muscular atrophy clinical types (P < 0.05).
23994529 identified an intronic region of the NAIP gene responding to TEAD1/YAP activity, suggesting that regulation of NAIP by TEAD1/YAP is at the transcriptional level
23940371 /NAIP1 and NAIP2/5 formed a large oligomeric complex with NLRC4 in the presence of corresponding bacterial ligands, and could support reconstitution of the NLRC4 inflammasome in a ligand-specific manner.
23012363 the NAIP5-NLRC4 inflammasome is induced by direct interactions with conserved N- and C-terminal regions of flagellin
22067212 NAIPFull gene duplication might have been evolutionary maintained, or even selected for, because it may confer an advantage to the host against flagellated bacteria
More...

AA Sequence

MATQQKASDERISQFDHNLLPELSALLGLDAVQLAKELEEEEQKERAKMQKGYNSQMRSEAKRLKTFVTY      1 - 70
EPYSSWIPQEMAAAGFYFTGVKSGIQCFCCSLILFGAGLTRLPIEDHKRFHPDCGFLLNKDVGNIAKYDI     71 - 140
RVKNLKSRLRGGKMRYQEEEARLASFRNWPFYVQGISPCVLSEAGFVFTGKQDTVQCFSCGGCLGNWEEG    141 - 210
DDPWKEHAKWFPKCEFLRSKKSSEEITQYIQSYKGFVDITGEHFVNSWVQRELPMASAYCNDSIFAYEEL    211 - 280
RLDSFKDWPRESAVGVAALAKAGLFYTGIKDIVQCFSCGGCLEKWQEGDDPLDDHTRCFPNCPFLQNMKS    281 - 350
SAEVTPDLQSRGELCELLETTSESNLEDSIAVGPIVPEMAQGEAQWFQEAKNLNEQLRAAYTSASFRHMS    351 - 420
LLDISSDLATDHLLGCDLSIASKHISKPVQEPLVLPEVFGNLNSVMCVEGEAGSGKTVLLKKIAFLWASG    421 - 490
CCPLLNRFQLVFYLSLSSTRPDEGLASIICDQLLEKEGSVTEMCVRNIIQQLKNQVLFLLDDYKEICSIP    491 - 560
QVIGKLIQKNHLSRTCLLIAVRTNRARDIRRYLETILEIKAFPFYNTVCILRKLFSHNMTRLRKFMVYFG    561 - 630
KNQSLQKIQKTPLFVAAICAHWFQYPFDPSFDDVAVFKSYMERLSLRNKATAEILKATVSSCGELALKGF    631 - 700
FSCCFEFNDDDLAEAGVDEDEDLTMCLMSKFTAQRLRPFYRFLSPAFQEFLAGMRLIELLDSDRQEHQDL    701 - 770
GLYHLKQINSPMMTVSAYNNFLNYVSSLPSTKAGPKIVSHLLHLVDNKESLENISENDDYLKHQPEISLQ    771 - 840
MQLLRGLWQICPQAYFSMVSEHLLVLALKTAYQSNTVAACSPFVLQFLQGRTLTLGALNLQYFFDHPESL    841 - 910
SLLRSIHFPIRGNKTSPRAHFSVLETCFDKSQVPTIDQDYASAFEPMNEWERNLAEKEDNVKSYMDMQRR    911 - 980
ASPDLSTGYWKLSPKQYKIPCLEVDVNDIDVVGQDMLEILMTVFSASQRIELHLNHSRGFIESIRPALEL    981 - 1050
SKASVTKCSISKLELSAAEQELLLTLPSLESLEVSGTIQSQDQIFPNLDKFLCLKELSVDLEGNINVFSV   1051 - 1120
IPEEFPNFHHMEKLLIQISAEYDPSKLVKLIQNSPNLHVFHLKCNFFSDFGSLMTMLVSCKKLTEIKFSD   1121 - 1190
SFFQAVPFVASLPNFISLKILNLEGQQFPDEETSEKFAYILGSLSNLEELILPTGDGIYRVAKLIIQQCQ   1191 - 1260
QLHCLRVLSFFKTLNDDSVVEIAKVAISGGFQKLENLKLSINHKITEEGYRNFFQALDNMPNLQELDISR   1261 - 1330
HFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPI   1331 - 1400
IQK                                                                      1401 - 1403
//

Text Mined References (52)

PMID Year Title
26347229 2015 Role of Inhibitors of Apoptosis Proteins in Testicular Function and Male Fertility: Effects of Polydeoxyribonucleotide Administration in Experimental Varicocele.
26109648 2015 Cutting Edge: Inflammasome Activation in Primary Human Macrophages Is Dependent on Flagellin.
25888055 2015 Molecular characterization and copy number of SMN1, SMN2 and NAIP in Chinese patients with spinal muscular atrophy and unrelated healthy controls.
25330799 2015 Association of copy numbers of survival motor neuron gene 2 and neuronal apoptosis inhibitory protein gene with the natural history in a Chinese spinal muscular atrophy cohort.
25137037 2015 Modulation of chemotherapeutic drug resistance in neuroblastoma SK-N-AS cells by the neural apoptosis inhibitory protein and miR-520f.
24711022 2014 [Analysis and carrier screening for copy numbers of SMN and NAIP genes in children with spinal muscular atrophy].
23994529 2013 Interaction with the Yes-associated protein (YAP) allows TEAD1 to positively regulate NAIP expression.
23940371 2013 Human NAIP and mouse NAIP1 recognize bacterial type III secretion needle protein for inflammasome activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23012363 2012 Formation and structure of a NAIP5-NLRC4 inflammasome induced by direct interactions with conserved N- and C-terminal regions of flagellin.
More...