Property Summary

NCBI Gene PubMed Count 9
Grant Count 1
R01 Count 1
Funding $159,594
PubMed Score 66.07
PubTator Score 5.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 3.17 1.6

Gene RIF (3)

PMID Text
20423514 Tumor-specific antigen BAGE may play a role in the occurrence and development of ovarian cancer and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
18541613 BAGE loci were hypomethylated in 81% of colorectal carcinoma samples.
12461691 five new BAGE genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 and nine BAGE gene fragments mapping to the juxtacentromeric regions of chromosomes 9, 13, 18, and 21

AA Sequence

MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF                                 1 - 43
//

Text Mined References (10)

PMID Year Title
20423514 2010 Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
18541613 2008 BAGE hypomethylation, a new epigenetic biomarker for colon cancer detection.
15704127 2005 Frequent DNA hypomethylation of human juxtacentromeric BAGE loci in cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12676563 2003 BAGE genes generated by juxtacentromeric reshuffling in the Hominidae lineage are under selective pressure.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12461691 2002 New BAGE (B melanoma antigen) genes mapping to the juxtacentromeric regions of human chromosomes 13 and 21 have a cancer/testis expression profile.
12115308 2002 mRNA detection of tumor-rejection genes BAGE, GAGE, and MAGE in peritoneal fluid from patients with ovarian carcinoma as a potential diagnostic tool.
9847074 1998 Toward a complete human genome sequence.
7895173 1995 BAGE: a new gene encoding an antigen recognized on human melanomas by cytolytic T lymphocytes.