Property Summary

NCBI Gene PubMed Count 9
PubMed Score 72.48
PubTator Score 5.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.18 1.6

Gene RIF (3)

AA Sequence

MAARAVFLALSAQLLQARLMKEESPVVSWRLEPEDGTALCFIF                                 1 - 43
//

Text Mined References (10)

PMID Year Title