Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q13069 Q6FG72 GAGE-5
Symbols CT4.5

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.
9651357 1998 Isolation and characterization of PAGE-1 and GAGE-7. New genes expressed in the LNCaP prostate cancer progression model that share homology with melanoma-associated antigens.
7544395 1995 A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.