Property Summary

NCBI Gene PubMed Count 63
PubMed Score 131.91
PubTator Score 112.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute myeloid leukemia 1.100 1.9e-02
adult high grade glioma -2.600 2.3e-07
astrocytic glioma -1.700 2.4e-03
Astrocytoma, Pilocytic -2.300 1.0e-09
atypical teratoid / rhabdoid tumor -3.200 2.4e-13
ependymoma -2.000 1.4e-03
glioblastoma -2.400 2.1e-12
group 3 medulloblastoma 1.300 1.0e-02
interstitial lung disease 1.100 5.7e-04
malignant mesothelioma 1.300 1.4e-05
medulloblastoma, large-cell 1.400 4.6e-04
oligodendroglioma -1.800 1.0e-02
osteosarcoma -1.941 1.2e-05
Pick disease -1.400 3.5e-02
primitive neuroectodermal tumor 1.100 2.6e-04
psoriasis -2.100 1.6e-03
Rheumatoid arthritis 1.400 8.5e-03
subependymal giant cell astrocytoma -2.510 1.8e-02

Gene RIF (52)

AA Sequence

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK      1 - 70
NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY     71 - 140
NGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPK    141 - 210
EDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEE    211 - 280
EEDDDDDELEDEGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEA    281 - 350
NGDVFETFMFPCQHCERKFTTKQGLERHMHIHISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKP    351 - 420
SQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSSVVEENGEVKELHPCKYCKK    421 - 490
VFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVYVPSTEPEEEGEADDVYIMDISS    491 - 560
NISENLNYYIDGKIQTNNNTSNCDVIEMESASADLYGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLG    561 - 630
STNSEAKKRRTASPPALPKIKAETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVYLSSKLKQLLQTQDK    631 - 700
LTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPPSSPQHSPALRDFGKPSDGKAAWTDAGLTS    701 - 770
KKSKLESHSDSPAWSLSGRDERETVSPPCFDEYKMSKEWTASSAFSSVCNQQPLDLSSGVKQKAEGTGKT    771 - 840
PVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNEYNGIDLPVENPADGT    841 - 910
RSPSPCKSLEAQPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVL    911 - 980
TVATPPPPLLPTVPLPAPSSSASPHPCPSPLSNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPT    981 - 1050
LSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFKQEELENEGLKPREEPQSAA   1051 - 1120
EQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNI   1121 - 1190
FVCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEE   1191 - 1260
ELNDSSEELYTTIKIMASGIKTKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFT   1261 - 1330
TAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQP   1331 - 1400
KRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCNREFTYIGSL   1401 - 1470
NKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSG   1471 - 1540
PTQVPLPSSSFRSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRS   1541 - 1610
LHVRVQKSKAVLQSKSTLASKKRTDRFNIKSRERSGGPVTRSLQLAAAADLSENKREDGSAKQELKDFSY   1611 - 1680
SLRLASRCSPPAAPYITRQYRKVKAPAAAQFQGPFFKE                                   1681 - 1718
//

Text Mined References (73)

PMID Year Title