Property Summary

NCBI Gene PubMed Count 61
Grant Count 55
R01 Count 28
Funding $5,869,970.21
PubMed Score 124.70
PubTator Score 112.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.008
interstitial lung disease 1.100 0.001
malignant mesothelioma 1.300 0.000
astrocytic glioma -1.700 0.002
ependymoma -2.900 0.000
oligodendroglioma -1.800 0.010
psoriasis -2.200 0.000
glioblastoma -2.700 0.000
osteosarcoma -1.941 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -1.900 0.000
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -2.510 0.018
Pick disease -1.400 0.035
acute myeloid leukemia 1.100 0.019

Synonym

Accession Q13029 B1AJZ4 B5MC68 Q13149 Q14550 Q5THJ1 Q5VUL9
Symbols RIZ
KMT8
RIZ1
RIZ2
KMT8A
MTB-ZF
HUMHOXY1

Gene

PDB

2JV0   2QPW  

Gene RIF (50)

PMID Text
26690953 RIZ1 expression is negatively correlated with glioma differentiation and can serve as a predictor of glioma prognosis and thus could be a potential therapeutic target for patients with gliomas.
25987089 Loss of RIZ1 expression due to methylation is associated with Renal Cell Carcinoma.
25884948 PRDM2 downregulation may play a role in dopamine-agonist resistance and tumor recurrence in prolactinomas.
24993551 Results suggest that high expression of SMYD3 is related to the occurrence of esophageal squamous cell carcinoma. Also, its suppression promoted the expression of RIZ1 suggesting a signal transduction pathway between SMYD3 and RIZ1.
24966940 PRDM2, PRDM5, PRDM16 promoters are methylated and their expression is suppressed in lung cancer cells.
24115813 The development and progression of esophageal squamous cell carcinoma are related to the inactivation of RIZ1.
23098508 Reduction of RIZ1 expression aggravates the progression of liver fluke-related cholangiocarcinoma
22614009 RIZ1 expression is significantly downregulated as the formation of meningiomas progressed, and suggest that RIZ1 may represent a promising candidate tumor suppressor gene that contributes to malignant meningiomas.
22372344 RIZ1 may be a potential tumor suppressor in human esophageal squamous cell cancer.
22363126 Data suggest that promoter methylation may play an important role in the epigenetic silencing of RIZ1 gene expression in human esophageal squamous cell carcinoma.
More...

AA Sequence

MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK      1 - 70
NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY     71 - 140
NGEDNPEIAAAIEEERASARSKRSSPKSRKGKKKSQENKNKGNKIQDIQLKTSEPDFTSANMRDSAEGPK    141 - 210
EDEEKPSASALEQPATLQEVASQEVPPELATPAPAWEPQPEPDERLEAAACEVNDLGEEEEEEEEEDEEE    211 - 280
EEDDDDDELEDEGEEEASMPNENSVKEPEIRCDEKPEDLLEEPKTTSEETLEDCSEVTPAMQIPRTKEEA    281 - 350
NGDVFETFMFPCQHCERKFTTKQGLERHMHIHISTVNHAFKCKYCGKAFGTQINRRRHERRHEAGLKRKP    351 - 420
SQTLQPSEDLADGKASGENVASKDDSSPPSLGPDCLIMNSEKASQDTINSSVVEENGEVKELHPCKYCKK    421 - 490
VFGTHTNMRRHQRRVHERHLIPKGVRRKGGLEEPQPPAEQAQATQNVYVPSTEPEEEGEADDVYIMDISS    491 - 560
NISENLNYYIDGKIQTNNNTSNCDVIEMESASADLYGINCLLTPVTVEITQNIKTTQVPVTEDLPKEPLG    561 - 630
STNSEAKKRRTASPPALPKIKAETDSDPMVPSCSLSLPLSISTTEAVSFHKEKSVYLSSKLKQLLQTQDK    631 - 700
LTPAGISATEIAKLGPVCVSAPASMLPVTSSRFKRRTSSPPSSPQHSPALRDFGKPSDGKAAWTDAGLTS    701 - 770
KKSKLESHSDSPAWSLSGRDERETVSPPCFDEYKMSKEWTASSAFSSVCNQQPLDLSSGVKQKAEGTGKT    771 - 840
PVQWESVLDLSVHKKHCSDSEGKEFKESHSVQPTCSAVKKRKPTTCMLQKVLLNEYNGIDLPVENPADGT    841 - 910
RSPSPCKSLEAQPDPDLGPGSGFPAPTVESTPDVCPSSPALQTPSLSSGQLPPLLIPTDPSSPPPCPPVL    911 - 980
TVATPPPPLLPTVPLPAPSSSASPHPCPSPLSNATAQSPLPILSPTVSPSPSPIPPVEPLMSAASPGPPT    981 - 1050
LSSSSSSSSSSSSFSSSSSSSSPSPPPLSAISSVVSSGDNLEASLPMISFKQEELENEGLKPREEPQSAA   1051 - 1120
EQDVVVQETFNKNFVCNVCESPFLSIKDLTKHLSIHAEEWPFKCEFCVQLFKDKTDLSEHRFLLHGVGNI   1121 - 1190
FVCSVCKKEFAFLCNLQQHQRDLHPDKVCTHHEFESGTLRPQNFTDPSKAHVEHMQSLPEDPLETSKEEE   1191 - 1260
ELNDSSEELYTTIKIMASGIKTKDPDVRLGLNQHYPSFKPPPFQYHHRNPMGIGVTATNFTTHNIPQTFT   1261 - 1330
TAIRCTKCGKGVDNMPELHKHILACASASDKKRYTPKKNPVPLKQTVQPKNGVVVLDNSGKNAFRRMGQP   1331 - 1400
KRLNFSVELSKMSSNKLKLNALKKKNQLVQKAILQKNKSAKQKADLKNACESSSHICPYCNREFTYIGSL   1401 - 1470
NKHAAFSCPKKPLSPPKKKVSHSSKKGGHSSPASSDKNSNSNHRRRTADAEIKMQSMQTPLGKTRARSSG   1471 - 1540
PTQVPLPSSSFRSKQNVKFAASVKSKKPSSSSLRNSSPIRMAKITHVEGKKPKAVAKNHSAQLSSKTSRS   1541 - 1610
LHVRVQKSKAVLQSKSTLASKKRTDRFNIKSRERSGGPVTRSLQLAAAADLSENKREDGSAKQELKDFSY   1611 - 1680
SLRLASRCSPPAAPYITRQYRKVKAPAAAQFQGPFFKE                                   1681 - 1718
//

Text Mined References (70)

PMID Year Title
26690953 2015 RIZ1: a potential tumor suppressor in glioma.
25987089 2015 Aberrant Methylation of the 1p36 Tumor Suppressor Gene RIZ1 in Renal Cell Carcinoma.
25884948 2015 Lower PRDM2 expression is associated with dopamine-agonist resistance and tumor recurrence in prolactinomas.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
24993551 2014 Effect of the downregulation of SMYD3 expression by RNAi on RIZ1 expression and proliferation of esophageal squamous cell carcinoma.
24966940 2014 Methylation of PRDM2, PRDM5 and PRDM16 genes in lung cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24115813 2013 Alteration in gene expression profile and oncogenicity of esophageal squamous cell carcinoma by RIZ1 upregulation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098508 2012 Contribution of RIZ1 to regulation of proliferation and migration of a liver fluke-related cholangiocarcinoma cell.
More...