Property Summary

NCBI Gene PubMed Count 52
Grant Count 17
R01 Count 11
Funding $2,098,397.83
PubMed Score 145.46
PubTator Score 147.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -2.605 0.002
intraductal papillary-mucinous carcinoma... 1.500 0.023
pancreatic cancer 1.100 0.000
psoriasis -1.500 0.000
lung carcinoma -1.400 0.000
breast carcinoma -1.200 0.000
Breast cancer -2.300 0.000
invasive ductal carcinoma -1.500 0.021
ovarian cancer -2.400 0.000
pituitary cancer 1.100 0.038

Gene RIF (41)

PMID Text
26672991 PLA2R1 expression in breast cancer cells is controlled by DNA methylation and histone modifications
26645973 genetic polymorphism is associated with systemic lupus erythematosus and lupus nephritis in a Chinese patients
26576418 Accordingly, PLA2R ABs assay seems to be promising tool not only to diagnose MN but also to predict the course of the disease and could open the way to personalize therapy. [review]
26393352 Data indicate that enhanced granular expression of phospholipase A2 receptor (PLA2R) and thrombospondin type-1 domain-containing 7A (THSD7A) was detected in 9.1% and 52.7%, respectively, of the patients with idiopathic membranous nephropathy (MN).
26194981 Suggest that PLA2R has a contributory role in the pathogenesis of paediatric idiopathic membranous nephropathy.
26087695 Renal biopsy PLA2R positivity was common in idiopathic membranous nephropathy (MN) and HBV-MN but rare in lupus-associated MN, and it was closely associated with serum PLA2R-Ab production.
26031599 Case Report: PLA2R positive membranous nephropathy in kidney transplant recipient with both IgA nephropathy and HCV infection long after kidney transplant from identical twin.
25953939 The detection and measurement of PLA2R-AB in idiopathic membranous nephropathy patients may be important tool in monitoring of the disease and efficacy of the treatment.
25740009 serological anti-PLA2R testing has diagnostic value for differentiating iMN from sMN, but it must be interpreted in context with patient clinical characteristics (degree of proteinuria, immunosuppressive treatment, time of detection).
25724334 Study showed that CTLD1-2 as well as the FNII domain of PLA2R were responsible for binding to collagen I and collagen-dependent migration in both mouse and human PLA2R.
More...

AA Sequence

MLLSPSLLLLLLLGAPRGCAEGVAAALTPERLLEWQDKGIFVIQSESLKKCIQAGKSVLTLENCKQANKH      1 - 70
MLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLVSLRWRCNRKMITGPLQYSVQVAHDNTVVA     71 - 140
SRKYIHKWISYGSGGGDICEYLHKDLHTIKGNTHGMPCMFPFQYNHQWHHECTREGREDDLLWCATTSRY    141 - 210
ERDEKWGFCPDPTSAEVGCDTIWEKDLNSHICYQFNLLSSLSWSEAHSSCQMQGGTLLSITDETEENFIR    211 - 280
EHMSSKTVEVWMGLNQLDEHAGWQWSDGTPLNYLNWSPEVNFEPFVEDHCGTFSSFMPSAWRSRDCESTL    281 - 350
PYICKKYLNHIDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHEALRSCQADNSALIDITSLA    351 - 420
EVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKV    421 - 490
KNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFDQASSGYYCPPALVTITNRFEQAF    491 - 560
ITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPVGQKPEPVQYTHWNTHQPRYSGGCVAMRGRHPLGRWE    561 - 630
VKHCRHFKAMSLCKQPVENQEKAEYEERWPFHPCYLDWESEPGLASCFKVFHSEKVLMKRTWREAEAFCE    631 - 700
EFGAHLASFAHIEEENFVNELLHSKFNWTEERQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNTYFGED    701 - 770
ARNCAVYKANKTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWLNFEFVC    771 - 840
SWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEERANDEFRWRDGTPVIYQNWDTGRERTVNNQ    841 - 910
SQRCGFISSITGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGTCPKGWLYFNYKCLLLNIPKDPSS    911 - 980
WKNWTHAQHFCAEEGGTLVAIESEVEQAFITMNLFGQTTSVWIGLQNDDYETWLNGKPVVYSNWSPFDII    981 - 1050
NIPSHNTTEVQKHIPLCALLSSNPNFHFTGKWYFEDCGKEGYGFVCEKMQDTSGHGVNTSDMYPMPNTLE   1051 - 1120
YGNRTYKIINANMTWYAAIKTCLMHKAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDG   1121 - 1190
TKSSFTFWKDEESSLLGDCVFADSNGRWHSTACESFLQGAICHVPPETRQSEHPELCSETSIPWIKFKSN   1191 - 1260
CYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNAQFDGNNETIKWFD   1261 - 1330
GTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFICKMEADIHTAEALPEKGPSHSIIP   1331 - 1400
LAVVLTLIVIVAICTLSFCIYKHNGGFFRRLAGFRNPYYPATNFSTVYLEENILISDLEKSDQ          1401 - 1463
//

Text Mined References (55)

PMID Year Title
26672991 2015 Epigenetic control of phospholipase A2 receptor expression in mammary cancer cells.
26645973 2016 Single-nucleotide polymorphisms in the PLA2R1 gene are associated with systemic lupus erythematosus and lupus nephritis in a Chinese Han population.
26576418 2015 Antiphospholipase A2 Receptor Autoantibodies: A Step Forward in the Management of Primary Membranous Nephropathy.
26393352 2015 Prevalence of Enhanced Granular Expression of Thrombospondin Type-1 Domain-Containing 7A in the Glomeruli of Japanese Patients with Idiopathic Membranous Nephropathy.
26194981 2015 Antibodies to m-type phospholipase A2 receptor in children with idiopathic membranous nephropathy.
26087695 2015 Renal phospholipase A2 receptor in hepatitis B virus-associated membranous nephropathy.
26031599 2015 Phospholipase A2 receptor positive membranous nephropathy long after living donor kidney transplantation between identical twins.
25953939 2015 Association of anti-phospholipasea2-receptor antibodies with clinical course of idiopathic membranous nephropathy.
25740009 2015 Diagnostic accuracy of PLA2R autoantibodies and glomerular staining for the differentiation of idiopathic and secondary membranous nephropathy: an updated meta-analysis.
25724334 2015 C-type lectin-like domain and fibronectin-like type II domain of phospholipase A(2) receptor 1 modulate binding and migratory responses to collagen.
More...