Property Summary

NCBI Gene PubMed Count 9
PubMed Score 876.01
PubTator Score 47.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung adenocarcinoma 2714 2.43059316854232E-18
ovarian cancer 8492 1.87271551223054E-7
posterior fossa group A ependymoma 1511 2.55172411669591E-7
atypical teratoid / rhabdoid tumor 4369 2.37058839699345E-6
medulloblastoma 1524 1.02325600038736E-5
pilocytic astrocytoma 3086 6.28113166444597E-4
glioblastoma 5572 0.00222902688039445
primitive neuroectodermal tumor 3031 0.00327656716010559
oligodendroglioma 2849 0.00746271209761124
astrocytic glioma 2241 0.00965329063679539
pediatric high grade glioma 2712 0.0161485357536961
osteosarcoma 7933 0.0275761483985408
X-linked cerebral adrenoleukodystrophy 115 0.0469323943959732
Disease Target Count Z-score Confidence
Neurodegenerative disease 383 3.472 1.7
Disease Target Count Z-score Confidence
Cancer 2346 5.24 2.6
Alexander disease 9 4.603 2.3
Vascular disease 281 4.409 2.2

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.010
posterior fossa group A ependymoma -1.700 0.000
oligodendroglioma -1.400 0.007
glioblastoma -1.500 0.002
osteosarcoma 1.649 0.028
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
primitive neuroectodermal tumor -1.600 0.003
X-linked cerebral adrenoleukodystrophy -2.200 0.047
pediatric high grade glioma -1.100 0.016
pilocytic astrocytoma -1.500 0.001
lung adenocarcinoma -1.800 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q12988 HspB3
Symbols HMN2C
DHMN2C
HSPL27

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
22610661 HspB3 exhibits chaperone-like activity.
20142617 an HSPB3 mutation associated with an axonal motor neuropathy
16225851 Our results suggest that a variety of oligomers composed of different proportions of different sHSPs may form in cell types expressing multiple sHSPs.

AA Sequence

MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH      1 - 70
FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV     71 - 140
VEVKDPVGTK                                                                141 - 150
//

Text Mined References (9)

PMID Year Title
22610661 2012 Structural aspects and chaperone activity of human HspB3: role of the "C-terminal extension".
20142617 2010 Mutant small heat shock protein B3 causes motor neuropathy: utility of a candidate gene approach.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
16225851 2005 Interactions of HSP22 (HSPB8) with HSP20, alphaB-crystallin, and HSPB3.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10625651 2000 Muscle develops a specific form of small heat shock protein complex composed of MKBP/HSPB2 and HSPB3 during myogenic differentiation.
9858786 1998 HspB3, the most deviating of the six known human small heat shock proteins.
8972725 1996 Isolation and characterization of a human heart cDNA encoding a new member of the small heat shock protein family--HSPL27.