Property Summary

NCBI Gene PubMed Count 10
PubMed Score 910.80
PubTator Score 47.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 9.7e-03
Astrocytoma, Pilocytic -1.500 5.4e-04
atypical teratoid / rhabdoid tumor -1.900 2.4e-06
ependymoma -1.600 8.3e-03
glioblastoma -1.500 2.2e-03
group 4 medulloblastoma -1.500 1.8e-02
lung adenocarcinoma -1.800 2.4e-18
oligodendroglioma -1.400 7.5e-03
osteosarcoma 1.649 2.8e-02
ovarian cancer -1.200 1.9e-07
pediatric high grade glioma -1.100 1.6e-02
primitive neuroectodermal tumor -1.600 3.3e-03
X-linked cerebral adrenoleukodystrophy -2.200 4.7e-02

Gene RIF (4)

AA Sequence

MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH      1 - 70
FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV     71 - 140
VEVKDPVGTK                                                                141 - 150
//

Text Mined References (10)

PMID Year Title