Property Summary

NCBI Gene PubMed Count 9
Grant Count 145
R01 Count 82
Funding $12,970,069.3
PubMed Score 876.01
PubTator Score 47.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.010
posterior fossa group A ependymoma -1.700 0.000
oligodendroglioma -1.400 0.007
glioblastoma -1.500 0.002
osteosarcoma 1.649 0.028
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
primitive neuroectodermal tumor -1.600 0.003
X-linked cerebral adrenoleukodystrophy -2.200 0.047
pediatric high grade glioma -1.100 0.016
pilocytic astrocytoma -1.500 0.001
lung adenocarcinoma -1.800 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q12988 HspB3
Symbols HMN2C
DHMN2C
HSPL27

Gene

PANTHER Protein Class (1)

Gene RIF (3)

PMID Text
22610661 HspB3 exhibits chaperone-like activity.
20142617 an HSPB3 mutation associated with an axonal motor neuropathy
16225851 Our results suggest that a variety of oligomers composed of different proportions of different sHSPs may form in cell types expressing multiple sHSPs.

AA Sequence

MAKIILRHLIEIPVRYQEEFEARGLEDCRLDHALYALPGPTIVDLRKTRAAQSPPVDSAAETPPREGKSH      1 - 70
FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGFISRSFTRQYKLPDGVEIKDLSAVLCHDGILV     71 - 140
VEVKDPVGTK                                                                141 - 150
//

Text Mined References (9)

PMID Year Title
22610661 2012 Structural aspects and chaperone activity of human HspB3: role of the "C-terminal extension".
20142617 2010 Mutant small heat shock protein B3 causes motor neuropathy: utility of a candidate gene approach.
19464326 2009 HSPB7 is a SC35 speckle resident small heat shock protein.
16225851 2005 Interactions of HSP22 (HSPB8) with HSP20, alphaB-crystallin, and HSPB3.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10625651 2000 Muscle develops a specific form of small heat shock protein complex composed of MKBP/HSPB2 and HSPB3 during myogenic differentiation.
9858786 1998 HspB3, the most deviating of the six known human small heat shock proteins.
8972725 1996 Isolation and characterization of a human heart cDNA encoding a new member of the small heat shock protein family--HSPL27.