Property Summary

NCBI Gene PubMed Count 20
PubMed Score 216.14
PubTator Score 45.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.300 1.5e-03
atypical teratoid / rhabdoid tumor -1.500 2.0e-05
Chronic Lymphocytic Leukemia 1.423 1.0e-02
glioblastoma -1.200 9.1e-06
group 3 medulloblastoma -1.100 2.6e-02
intraductal papillary-mucinous carcinoma... 1.200 4.4e-02
medulloblastoma, large-cell -2.800 3.2e-05
osteosarcoma -2.375 3.3e-08
ovarian cancer -1.700 4.1e-07
primitive neuroectodermal tumor -1.200 3.2e-03

Gene RIF (3)

AA Sequence

MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDG      1 - 70
VSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIF     71 - 140
YKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQK    141 - 210
ISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSS    211 - 280
INEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYI    281 - 350
PLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL    351 - 420
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPV    421 - 490
TSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELE    491 - 560
GSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRD    561 - 630
MSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDA    631 - 700
NNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLI    701 - 770
TFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH    771 - 840
PPISFAELKRNTLYFSTDV                                                       841 - 859
//

Text Mined References (21)

PMID Year Title