Property Summary

NCBI Gene PubMed Count 20
Grant Count 34
R01 Count 7
Funding $10,103,217.63
PubMed Score 194.96
PubTator Score 45.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (3)

PMID Text
24162774 HIV-1 gp120 upregulates the expression of active BCR-related (ABR) in human B cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11921339 During vestibular morphogenesis, Abr and Bcr play complementary roles. Small Rho-related GTPases like Abr and Bcr are important for balance and motor coordination.

AA Sequence

MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDG      1 - 70
VSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIF     71 - 140
YKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQK    141 - 210
ISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSS    211 - 280
INEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYI    281 - 350
PLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL    351 - 420
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPV    421 - 490
TSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELE    491 - 560
GSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRD    561 - 630
MSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDA    631 - 700
NNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLI    701 - 770
TFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH    771 - 840
PPISFAELKRNTLYFSTDV                                                       841 - 859
//

Text Mined References (21)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15525470 2004 Yeast two-hybrid screening for proteins that interact with alpha1-adrenergic receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
More...