Property Summary

NCBI Gene PubMed Count 18
PubMed Score 128.66
PubTator Score 45.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.100 4.9e-04
lung cancer -1.500 1.1e-02
malignant mesothelioma -1.200 6.8e-06

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MYRRSYVFQTRKEQYEHADEASRAAEPERPADEGWAGATSLAALQGLGERVAAHVQRARALEQRHAGLRR      1 - 70
QLDAFQRLGELAGPEDALARQVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM     71 - 140
LERLNKEADEALLHNLRLQLEAQFLQDDISAAKDRHKKNLLEVQTYISILQQIIHTTPPASIVTSGMREE    141 - 210
KLLTEREVAALRSQLEEGREVLSHLQAQRVELQAQTTTLEQAIKSAHECYDDEIQLYNEQIETLRKEIEE    211 - 280
TERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKDLT    281 - 350
RALQDITAAKPRQKALPKNVPRRKEIITKDKTNGALEDAPLKGLEDTKLVQVVLKEESESKFESESKEVS    351 - 420
PLTQEGAPEDVPDGGQISKGFGKLYRKVKEKVRSPKEPETPTELYTKERHVLVTGDANYVDPRFYVSSIT    421 - 490
AKGGVAVSVAEDSVLYDGQVEPSPESPKPPLENGQVGLQEKEDGQPIDQQPIDKEIEPDGAELEGPEEKR    491 - 560
EGEERDEESRRPCAMVTPGAEEPSIPEPPKPAADQDGAEVLGTRSRSLPEKGPPKALAYKTVEVVESIEK    561 - 630
ISTESIQTYEETAVIVETMIGKTKSDKKKSGEKSS                                       631 - 665
//

Text Mined References (20)

PMID Year Title