Property Summary

NCBI Gene PubMed Count 54
PubMed Score 333.02
PubTator Score 163.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
psoriasis 1.300 2.5e-27
adult high grade glioma 1.200 1.5e-03
Breast cancer -1.200 2.4e-14
colon cancer -1.500 1.2e-02
cutaneous lupus erythematosus 2.100 3.6e-03
interstitial cystitis 2.000 2.1e-02
intraductal papillary-mucinous carcinoma... -1.600 9.5e-04
intraductal papillary-mucinous neoplasm ... -2.000 2.5e-03
lung adenocarcinoma -1.100 2.6e-05
lung carcinoma -1.500 2.5e-14
malignant mesothelioma 1.200 8.8e-04
nasopharyngeal carcinoma -1.100 1.0e-03
non-small cell lung cancer -1.326 1.3e-09
osteosarcoma -2.943 8.3e-04
pancreatic cancer -1.800 3.5e-03
pancreatic carcinoma -1.800 3.5e-03
pancreatic ductal adenocarcinoma liver m... -1.071 1.9e-02
primary Sjogren syndrome 1.100 7.2e-03
sarcoidosis 1.600 1.2e-02

Gene RIF (42)

AA Sequence

MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSVSVTSLIQKSS      1 - 70
IEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH     71 - 140
TQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWIC    141 - 210
QKELTPVRNKVYPDS                                                           211 - 225
//

Text Mined References (55)

PMID Year Title