Property Summary

NCBI Gene PubMed Count 50
Grant Count 54
R01 Count 34
Funding $4,961,331.75
PubMed Score 313.92
PubTator Score 163.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Gene RIF (38)

PMID Text
26829983 these data suggest that LLT1-CD161 interactions play a novel and important role in B cell maturation within the Germinal center in humans.
26643453 Our results reveal that in combination with IGRAs, CD161-based indices provide a novel, fast diagnostic solution addressing the limitation of current tuberculosis diagnostics.
26309225 The regulation of NK cell homeostasis and activation apparently differs between carriers of the CC and TT variant of CD161.
26062995 CD161-expressing Th17 cells are enriched at sites of autoinflammation, are highly proinflammatory and resistant to Treg-mediated suppression suggesting their important pathogenic role in rheumatoid arthritis.
26059452 We suggest modulation of human Th17 responsiveness by CD39 and CD161 and describe novel molecular mechanisms integrating elements of both extracellular nucleotide and sphingolipid homeostasis--{REVIEW}
25906076 percentage of alveolar CD3(+)CD161(+) T lymphocytes that produced IFN-gamma/IL-17 was significantly higher than those in the peripheral blood
25543092 these results suggest that the CD8(+) subset of CD161(+) T cells may have regulatory effects and that they provide a basis for predicting the occurrence of aGVHD after allogeneic SCT.
25437561 Expression of CD161 hence identifies a transcriptional and functional phenotype, shared across human T lymphocytes.
25172498 CD39 and CD161 modulate human Th17 responses in CD through alterations in purinergic nucleotide-mediated responses and ASM catalytic bioactivity, respectively.
24975965 Elevated expression of CD69 and CD161 on NK cells can be considered as immunological risk markers in RSA and IVF failure.
More...

AA Sequence

MDQQAIYAELNLPTDSGPESSSPSSLPRDVCQGSPWHQFALKLSCAGIILLVLVVTGLSVSVTSLIQKSS      1 - 70
IEKCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH     71 - 140
TQNLIRDKAILFWIGLNFSLSEKNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWIC    141 - 210
QKELTPVRNKVYPDS                                                           211 - 225
//

Text Mined References (51)

PMID Year Title
26829983 2016 LLT1 and CD161 Expression in Human Germinal Centers Promotes B Cell Activation and CXCR4 Downregulation.
26643453 2015 Discriminating Active Tuberculosis from Latent Tuberculosis Infection by flow cytometric measurement of CD161-expressing T cells.
26309225 2015 The c.503T>C Polymorphism in the Human KLRB1 Gene Alters Ligand Binding and Inhibitory Potential of CD161 Molecules.
26062995 2015 Polyfunctional, Pathogenic CD161+ Th17 Lineage Cells Are Resistant to Regulatory T Cell-Mediated Suppression in the Context of Autoimmunity.
26059452 2015 Beyond ecto-nucleotidase: CD39 defines human Th17 cells with CD161.
25906076 2015 CD161 Expression Defines a Th1/Th17 Polyfunctional Subset of Resident Memory T Lymphocytes in Bronchoalveolar Cells.
25543092 2015 CD161(+) T cells as predictive markers for acute graft-versus-host disease.
25437561 2014 CD161 defines a transcriptional and functional phenotype across distinct human T cell lineages.
25172498 2014 CD39 and CD161 modulate Th17 responses in Crohn's disease.
24975965 2014 Increase of CD69, CD161 and CD94 on NK cells in women with recurrent spontaneous abortion and in vitro fertilization failure.
More...