Property Summary

NCBI Gene PubMed Count 78
PubMed Score 138.61
PubTator Score 184.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
LEUKODYSTROPHY, HYPOMYELINATING, 3 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Neuritis 5 3.209 1.6
Cancer 2499 3.153 1.6
Disease Target Count
Leukodystrophy, hypomyelinating 3 1

Expression

  Differential Expression (11)

Protein-protein Interaction (9)

Gene RIF (52)

AA Sequence

MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAE      1 - 70
IQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQS     71 - 140
IAGSADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILL    141 - 210
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT    211 - 280
NDECVATYKGVPFEVKGKGVCRAQTMSNSGIK                                          281 - 312
//

Text Mined References (90)

PMID Year Title