Property Summary

NCBI Gene PubMed Count 71
Grant Count 29
R01 Count 18
Funding $5,522,329.31
PubMed Score 136.61
PubTator Score 184.08

Knowledge Summary

Patent

No data available

Expression

Gene RIF (48)

PMID Text
27089716 Increased serum level of EMAP-II may be one of the pathways of endothelial dysfunction in type 1 diabetes.
26325028 AIMp1 promotes the proliferation and migration of fibroblasts/endothelial cells and importantly, pro-inflammatory gene expression in monocytes/macrophages and dendritic cells.
26173967 two homozygous missense variants, p.(Gly299Arg) and p.(Val176Gly), in the gene AIMP1 that co-segregated with the phenotype, are reported.
26142824 findings suggest EMAP II is elevated in type 1 diabetic patients, particularly those with micro-vascular complications; EMAP II levels are related to inflammation, glycemic control, albuminuria level of patients and the risk of micro-vascular complications
26040042 EMAP2 is a multifunctional polypeptide with proinflammatory and antiangiogenic activity. (Review)
25724651 Data indicate that the N terminus of Pro-EMAP II binds to its C terminus, arginyl-tRNA synthetase, and the neurofilament light subunit.
25288775 interactions between the N-terminal domains of ArgRS and AIMP1 are important for the catalytic and noncatalytic activities of ArgRS and for the assembly of the higher-order MSC protein complex with ArgRS-GlnRS-AIMP1
25146391 AIMP1 appears to function as a novel inhibitor of PPARgamma that regulates adipocyte differentiation by preventing the transcriptional activation of PPARgamma.
25010285 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 1 (AIMP1) is identified in a series of six affinity purification/mass spectrometry screens
24816397 Data indicate that HCV E2 glycoprotein interacts with cellular AIMP1/p43 protein and promotes cell surface expression of membrane glycoproteins gp96 and transforming growth factor beta TGF-beta signaling.
More...

AA Sequence

MANNDAVLKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKEIEELKQELIQAE      1 - 70
IQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTKEQIKGGTGDEKKAKEKIEKKGEKKEKKQQS     71 - 140
IAGSADSKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILL    141 - 210
CNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHT    211 - 280
NDECVATYKGVPFEVKGKGVCRAQTMSNSGIK                                          281 - 312
//

Text Mined References (83)

PMID Year Title
27089716 [SERUM LEVEL OF ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE-II IN CHILDHOOD-ONSET TYPE 1 DIABETIC PATIENTS AND OBESE ADOLESCENTS].
26325028 2015 Stepping Out of the Cytosol: AIMp1/p43 Potentiates the Link Between Innate and Adaptive Immunity.
26173967 2016 Missense variants in AIMP1 gene are implicated in autosomal recessive intellectual disability without neurodegeneration.
26142824 2015 Endothelial monocyte activating polypeptide II in children and adolescents with type 1 diabetes mellitus: Relation to micro-vascular complications.
26040042 2015 [Endothelial monocyte-activating polypeptide-II: properties, functions, and pathogenetic significance].
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25724651 2015 The N terminus of pro-endothelial monocyte-activating polypeptide II (EMAP II) regulates its binding with the C terminus, arginyl-tRNA synthetase, and neurofilament light protein.
25416956 2014 A proteome-scale map of the human interactome network.
25288775 2014 Structure of the ArgRS-GlnRS-AIMP1 complex and its implications for mammalian translation.
25146391 2014 AIMP1 negatively regulates adipogenesis by inhibiting PPAR?.
More...