Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.80
PubTator Score 5.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.5e-05
medulloblastoma, large-cell 6241 1.4e-04
psoriasis 6694 2.0e-04
colon cancer 1478 4.5e-03
lung cancer 4740 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cholecystolithiasis 5 3.925 2.0
Dumping syndrome 8 3.636 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
colon cancer 1.200 4.5e-03
lung cancer 1.300 1.2e-02
medulloblastoma, large-cell 1.100 1.4e-04
ovarian cancer 1.300 2.5e-05
psoriasis 1.900 2.0e-04

Synonym

Accession Q12894 Q9BVB4 Q9UJ88
Symbols SM15
IFNRP
SKMc15

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 GO Component (1)

 Compartment GO Term (2)

Gene RIF (5)

AA Sequence

MAWNSPSRRPVWQGGAPREDGGARGVWLPSSGQVSAQRTGRRLVGLEPTPTGSLTPRPPRPVPGMPRARK      1 - 70
GNTLRKGGQRRGGGARSSAQADSGSSDDEAASEARSTASECPSLLSTTAEDSLGGDVVDEQGQQEDLEEK     71 - 140
LKEYVDCLTDKSAKTRQGALESLRLALASRLLPDFLLERRLTLADALEKCLKKGKGEEQALAAAVLGLLC    141 - 210
VQLGPGPKGEELFHSLQPLLVSVLSDSTASPAARLHCASALGLGCYVAAADIQDLVSCLACLESVFSRFY    211 - 280
GLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIAL    281 - 350
LFELARDLEEEFVYEDMEALCSVLRTLATDSNKYRAKADRRRQRSTFRAVLHSVEGGECEEEIVRFGFEV    351 - 420
LYMDSWARHRIYAAFKEVLGSGMHHHLQNNELLRDIFGLGPVLLLDATALKACKVPRFEKHLYNAAAFKA    421 - 490
RTKARSRVRDKRADIL                                                          491 - 506
//

Text Mined References (11)

PMID Year Title