Property Summary

NCBI Gene PubMed Count 10
PubMed Score 16.46
PubTator Score 5.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.900 0.000
medulloblastoma, large-cell 1.100 0.000
lung cancer 1.300 0.012
colon cancer 1.200 0.004
ovarian cancer 1.300 0.000

Gene RIF (5)

PMID Text
20689807 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of interferon-related developmental regulator 2 (IFRD2) by siRNA has both activating and inhibiting activities on HIV-1 replication in HeLa P4/R5 cells, suggesting a regulatory role in HIV replication
9722946 Identification of a new family of IFRD (interferon developmental regulator) genes, of which SkMC15 is part, being named IFDR2
9722946 Identification of the IFRD gene family, comprising the two genes PC4 / Tis7 / IFRD1 and SKMc15 / IFRD2, and in situ-hybridization analysis of their expression during developments
9722946 This publication discusses both IFRD1 and IFRD2.

AA Sequence

MAWNSPSRRPVWQGGAPREDGGARGVWLPSSGQVSAQRTGRRLVGLEPTPTGSLTPRPPRPVPGMPRARK      1 - 70
GNTLRKGGQRRGGGARSSAQADSGSSDDEAASEARSTASECPSLLSTTAEDSLGGDVVDEQGQQEDLEEK     71 - 140
LKEYVDCLTDKSAKTRQGALESLRLALASRLLPDFLLERRLTLADALEKCLKKGKGEEQALAAAVLGLLC    141 - 210
VQLGPGPKGEELFHSLQPLLVSVLSDSTASPAARLHCASALGLGCYVAAADIQDLVSCLACLESVFSRFY    211 - 280
GLGGSSTSPVVPASLHGLLSAALQAWALLLTICPSTQISHILDRQLPRLPQLLSSESVNLRIAAGETIAL    281 - 350
LFELARDLEEEFVYEDMEALCSVLRTLATDSNKYRAKADRRRQRSTFRAVLHSVEGGECEEEIVRFGFEV    351 - 420
LYMDSWARHRIYAAFKEVLGSGMHHHLQNNELLRDIFGLGPVLLLDATALKACKVPRFEKHLYNAAAFKA    421 - 490
RTKARSRVRDKRADIL                                                          491 - 506
//

Text Mined References (11)

PMID Year Title
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20689807 2010 Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11085536 2000 The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.
9722946 1998 Cloning of the human interferon-related developmental regulator (IFRD1) gene coding for the PC4 protein, a member of a novel family of developmentally regulated genes.
More...