Property Summary

NCBI Gene PubMed Count 7
PubMed Score 267.34
PubTator Score 68.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 9.0e-05
breast carcinoma 1638 2.1e-03
fibroadenoma 559 1.3e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma -2.100 2.1e-03
fibroadenoma -3.000 1.3e-02
ovarian cancer -1.100 9.0e-05

Synonym

Accession Q12870 Q9NQQ1 TCF-15
Symbols EC2
PARAXIS
bHLHa40

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRGPGPGGGRRAGGGGGAGPVVV      1 - 70
VRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETVRLASSYIAHLANVLLLGDSADDGQPC     71 - 140
FRAAGSAKGAVPAAADGGRQPRSICTFCLSNQRKGGGRRDLGGSCLKVRGVAPLRGPRR               141 - 199
//

Text Mined References (7)

PMID Year Title