Property Summary

NCBI Gene PubMed Count 56
PubMed Score 80.57
PubTator Score 45.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Parkinson Disease 105
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 5.03390339314012E-9
ovarian cancer 8492 8.29643125324683E-9
posterior fossa group A ependymoma 1511 6.353112430908E-8
Breast cancer 3099 2.09011852586701E-6
osteosarcoma 7933 5.56945031708394E-6
colon cancer 1475 6.71608867826056E-5
adrenocortical carcinoma 1427 1.96948237747573E-4
pituitary cancer 1972 2.50204873411681E-4
astrocytoma 1493 2.95902775003898E-4
oligodendroglioma 2849 5.64141692748924E-4
Pick disease 1893 0.00107010671604242
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00126413788316665
sonic hedgehog group medulloblastoma 1482 0.00239684708555553
lung cancer 4473 0.00263631519892691
interstitial cystitis 2299 0.00288713303672143
Atopic dermatitis 944 0.00302405615003786
adrenocortical adenoma 134 0.00323697137348463
glioblastoma 5572 0.00331109496543595
subependymal giant cell astrocytoma 2287 0.00494818101574552
pediatric high grade glioma 2712 0.00961965938173292
primitive neuroectodermal tumor 3031 0.0133111274385067
medulloblastoma, large-cell 6234 0.0158406140945649
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.025874962409748
progressive supranuclear palsy 674 0.0361452249785084
Alzheimer's disease 644 0.0390531310944418
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Myopathy, congenital, Compton-North 1

Expression

Synonym

Accession Q12860 A8K0H9 A8K0Y3 Q12861 Q14030 Q7M4P0 Q8N466
Symbols F3
GP135
MYPCN

Gene

PDB

2EE2   3S97  

  Ortholog (12)

Gene RIF (20)

PMID Text
26795349 CNTN1 promotes prostate cancer progression.
26722434 CNTN1 is a new gene which can be regulated by RET/PTC3 (Ret proto-oncogene and Ret-activating protein ELE1) rearrangement gene and the protein level of CNTN1 is increasing in thyroid cancer.
26721881 Structurally, CASPR2 is highly glycosylated and has an overall compact architecture. CASPR2 associates with micromolar affinity with CNTN1 but, under the same conditions, it does not interact with any of the other members of the contactin family.
25960233 CNTN-1 is closely related with multidrug resistance of lung adenocarcinoma.
25952582 High CNTN-1 expression is associated with metastasis in gastric cancer.
25916117 under hypoxia conditions, elevated HIF-1alpha seems to up-regulate contactin-1 expression and by this activate RhoA and facilitate migration of cancer cells.
25808373 anti-CNTN1 IgG4 antibodies are associated with subacute onset of chronic inflammatory demyelinating polyneuropathy symptoms, sensory ataxia, and good response to corticosteroids.
23724143 activation of AKT plays a role in contactin-1-mediated downregulation of E-cadherin.
22581910 The expression of CNTN-1 is upregulated in esophageal squamous cell carcinoma tissue and is related to stage and lymphatic invasion. Thus, it may be involved in the pathogenesis & progression of esophageal squamous cell carcinoma.
22580838 A high expression of CNTN1 was markedly associated with the regional lymph node metastasis of patients with oral squamous cell carcinoma.
More...

AA Sequence

MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARAS      1 - 70
PFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPP     71 - 140
EERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYS    141 - 210
CFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLE    211 - 280
PMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW    281 - 350
PCVATGKPIPTIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM    351 - 420
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNR    421 - 490
GKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNF    491 - 560
MLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDN    561 - 630
HSPISKYTIQTKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIK    631 - 700
TDGAAPNVAPSDVGGGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHK    701 - 770
DETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY    771 - 840
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQPPR    841 - 910
IISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYVVEVRAHS    911 - 980
DGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF                                    981 - 1018
//

Text Mined References (61)

PMID Year Title
26795349 2016 Neural Cell Adhesion Protein CNTN1 Promotes the Metastatic Progression of Prostate Cancer.
26722434 2015 Contactin 1 as a potential biomarker promotes cell proliferation and invasion in thyroid cancer.
26721881 2016 Structural Characterization of the Extracellular Domain of CASPR2 and Insights into Its Association with the Novel Ligand Contactin1.
25960233 2015 Increased sensitivity of human lung adenocarcinoma cells to cisplatin associated with downregulated contactin-1.
25952582 2015 Significances of contactin-1 expression in human gastric cancer and knockdown of contactin-1 expression inhibits invasion and metastasis of MKN45 gastric cancer cells.
25916117 [Under hypoxia condition contactin-1 regulates migration of MKN45 cells through RhoA pathway].
25808373 2015 Contactin 1 IgG4 associates to chronic inflammatory demyelinating polyneuropathy with sensory ataxia.
24986923 2014 A genome-wide association study identifies susceptibility loci of silica-related pneumoconiosis in Han Chinese.
24842889 2014 Genome-wide mapping of IBD segments in an Ashkenazi PD cohort identifies associated haplotypes.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
More...