Property Summary

NCBI Gene PubMed Count 57
PubMed Score 87.57
PubTator Score 45.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myopathy, Congenital, Compton-North 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Bipolar Disorder 666 0.0 0.7

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical adenoma -1.156 3.2e-03
adrenocortical carcinoma -1.486 2.0e-04
adult high grade glioma -1.800 2.3e-02
Alzheimer's disease -1.400 3.9e-02
astrocytoma -1.100 3.0e-04
Atopic dermatitis -1.500 1.3e-02
atypical teratoid / rhabdoid tumor -2.600 6.1e-11
Breast cancer -1.100 2.9e-06
colon cancer -2.300 6.7e-05
glioblastoma -2.100 1.8e-02
group 3 medulloblastoma -1.900 4.2e-04
interstitial cystitis -1.600 9.5e-03
intraductal papillary-mucinous adenoma (... -2.200 2.1e-03
intraductal papillary-mucinous neoplasm ... -2.100 2.5e-02
lung cancer 2.000 2.6e-03
medulloblastoma, large-cell -1.800 1.7e-03
oligodendroglioma -1.200 5.6e-04
osteosarcoma 2.010 5.6e-06
ovarian cancer -2.600 8.3e-09
Pick disease -1.800 1.1e-03
pituitary cancer 1.300 4.5e-06
posterior fossa group A ependymoma 2.200 6.4e-08
primitive neuroectodermal tumor -2.000 8.2e-03
progressive supranuclear palsy -1.200 3.6e-02
subependymal giant cell astrocytoma -1.950 5.0e-03

Gene RIF (21)

AA Sequence

MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGKVSLNCRARAS      1 - 70
PFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNYGMVRSTEATLSFGYLDPFPP     71 - 140
EERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVFITMDKRRFVSQTNGNLYIANVEASDKGNYS    141 - 210
CFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLE    211 - 280
PMPSTAEISTSGAVLKIFNIQLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYW    281 - 350
PCVATGKPIPTIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM    351 - 420
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNR    421 - 490
GKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVWSFNGYVIDFNKENIHYQRNF    491 - 560
MLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVVRGPPGPPGGLRIEDIRATSVALTWSRGSDN    561 - 630
HSPISKYTIQTKTILSDDWKDAKTDPPIIEGNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIK    631 - 700
TDGAAPNVAPSDVGGGGGRNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHK    701 - 770
DETMSPSTAFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY    771 - 840
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFTKKAPPSQPPR    841 - 910
IISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKHSIEVPIPRDGEYVVEVRAHS    911 - 980
DGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF                                    981 - 1018
//

Text Mined References (62)

PMID Year Title