Property Summary

NCBI Gene PubMed Count 26
PubMed Score 90.17
PubTator Score 45.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 2.600 4.6e-03
medulloblastoma, large-cell 3.800 1.9e-03
non primary Sjogren syndrome sicca -1.200 2.1e-02

Gene RIF (11)

AA Sequence

MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGRS      1 - 70
SSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPDA     71 - 140
TYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPDG    141 - 210
AVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVG    211 - 280
SALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRT    281 - 350
SIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI               351 - 409
//

Text Mined References (29)

PMID Year Title