Property Summary

NCBI Gene PubMed Count 25
Grant Count 82
R01 Count 60
Funding $10,135,461.79
PubMed Score 86.95
PubTator Score 45.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
group 4 medulloblastoma 2.600 0.005
medulloblastoma, large-cell 3.800 0.002
non primary Sjogren syndrome sicca -1.200 0.021

Synonym

Accession Q12837 B1PJR6 B2RC84 Q13883 Q14987
Symbols BRN3B
BRN3.2
Brn-3b

Gene

Gene RIF (11)

PMID Text
26700620 DNA methylation in a combination of POU4F2/PCDH17 has yielded the highest sensitivity and specificity of 90.00% and 93.96% in all the 312 individuals, showing the capability of detecting bladder cancer effectively among pathologically varied sample groups.
25482012 The genes BCL6, NFE2, POU4F2 and ELF4 are primary 1,25(OH)2D3 targets in THP-1 cells
23056278 Methylation levels of EOMES, HOXA9, POU4F2, TWIST1, VIM, and ZNF154 in urine specimens are promising diagnostic biomarkers for bladder cancer recurrence surveillance
18367606 Brn3b specifies the RGC fate from multipotential precursors not only by promoting RGC differentiation but also by suppressing non-RGC differentiation programs as a safeguard mechanism.
17637757 May act to alter growth properties of breast cancer and neuroblastoma cells by enhancing cyclin D1 expression in these tumor cells.
17490655 Two different microRNAs that potentially regulate the stability of Brn-3b have been identified in neuroblastoma cells.
16152597 first time that a Brn-3b POU family transcription factor has been shown to regulate a member of the catenin family, which provides insight into the molecular mechanisms by which Brn-3b expression may favour breast cancer progression and tumor invasion
15968082 Brn-3b expression has been shown to be a prerequisite for developmental survival of most retinal ganglion cells.
15833836 Brn-3b can, directly and indirectly (via interaction with the ER), activate HSP-27 expression, and this may represent one mechanism by which Brn-3b mediates its effects in breast cancer cells.
14970234 Brn-3b transcription factor contributes to proliferation of neuroblastoma cells in vivo and in vitro but may also influence progression and/or invasion during tumorigenesis.
More...

AA Sequence

MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSTSPGSSAPIAPSASSPSSSSNAGGGGGGGGGGGGGGGRS      1 - 70
SSSSSSGSSGGGGSEAMRRACLPTPPSNIFGGLDESLLARAEALAAVDIVSQSKSHHHHPPHHSPFKPDA     71 - 140
TYHTMNTIPCTSAASSSSVPISHPSALAGTHHHHHHHHHHHHQPHQALEGELLEHLSPGLALGAMAGPDG    141 - 210
AVVSTPAHAPHMATMNPMHQAALSMAHAHGLPSHMGCMSDVDADPRDLEAFAERFKQRRIKLGVTQADVG    211 - 280
SALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRT    281 - 350
SIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAGI               351 - 409
//

Text Mined References (29)

PMID Year Title
26700620 2016 An epigenetic biomarker combination of PCDH17 and POU4F2 detects bladder cancer accurately by methylation analyses of urine sediment DNA in Han Chinese.
25482012 2015 The transcriptional regulator BCL6 participates in the secondary gene regulatory response to vitamin D.
23805044 2013 RIT2, a neuron-specific small guanosine triphosphatase, is expressed in retinal neuronal cells and its promoter is modulated by the POU4 transcription factors.
23056278 2012 Diagnosis of bladder cancer recurrence based on urinary levels of EOMES, HOXA9, POU4F2, TWIST1, VIM, and ZNF154 hypermethylation.
21279488 2011 Hsp-27 induction requires POU4F2/Brn-3b TF in doxorubicin-treated breast cancer cells, whereas phosphorylation alters its cellular localisation following drug treatment.
21241485 2011 Proliferation-associated POU4F2/Brn-3b transcription factor expression is regulated by oestrogen through ER? and growth factors via MAPK pathway.
19266028 2009 Genome-wide analysis of histidine repeats reveals their role in the localization of human proteins to the nuclear speckles compartment.
18367606 2008 A comprehensive negative regulatory program controlled by Brn3b to ensure ganglion cell specification from multipotential retinal precursors.
17637757 2008 Proliferation-associated Brn-3b transcription factor can activate cyclin D1 expression in neuroblastoma and breast cancer cells.
17490655 2007 Post-transcriptional regulation of the Brn-3b transcription factor in differentiating neuroblastoma cells.
More...