Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.45
PubTator Score 80.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -2.000 2.5e-04
Amyotrophic lateral sclerosis 1.124 1.4e-05
astrocytic glioma -2.600 7.7e-03
Astrocytoma, Pilocytic -1.100 8.7e-04
atypical teratoid / rhabdoid tumor -2.900 4.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.076 4.5e-03
Breast cancer -1.100 2.6e-07
ependymoma -2.900 1.1e-02
glioblastoma -1.800 5.9e-06
group 4 medulloblastoma -1.600 4.2e-04
intraductal papillary-mucinous adenoma (... 1.600 2.0e-03
intraductal papillary-mucinous carcinoma... 1.500 4.0e-03
intraductal papillary-mucinous neoplasm ... 1.600 9.8e-03
invasive ductal carcinoma -1.168 1.7e-05
lung cancer 1.100 2.2e-04
malignant mesothelioma -3.500 1.5e-08
medulloblastoma, large-cell -2.300 7.8e-05
oligodendroglioma -1.500 4.9e-02
osteosarcoma -1.721 1.9e-06
ovarian cancer 1.200 1.4e-02
Pick disease -1.100 7.9e-03
primitive neuroectodermal tumor -1.700 2.7e-03
psoriasis -1.200 5.8e-09
tuberculosis 1.300 1.1e-05
ulcerative colitis -1.700 5.0e-07

Gene RIF (4)

AA Sequence

MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVD    141 - 210
KLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS      211 - 278
//

Text Mined References (10)

PMID Year Title