Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.45
PubTator Score 80.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 1.43992350491845E-14
pediatric high grade glioma 2712 2.14537458413379E-10
psoriasis 6685 5.80419637376645E-9
pilocytic astrocytoma 3086 5.86746253990358E-9
malignant mesothelioma 3163 1.53182217912783E-8
Breast cancer 3099 2.55546026631914E-7
atypical teratoid / rhabdoid tumor 4369 4.59964391398703E-7
ulcerative colitis 2087 4.96567494200554E-7
osteosarcoma 7933 1.92392026588691E-6
medulloblastoma, large-cell 6234 2.00492383606113E-6
glioblastoma 5572 4.45863864132676E-6
tuberculosis and treatment for 3 months 327 4.57105583588595E-6
medulloblastoma 1524 1.01475366955447E-5
Amyotrophic Lateral Sclerosis 432 1.38611555236991E-5
invasive ductal carcinoma 2950 1.72275699557377E-5
primitive neuroectodermal tumor 3031 5.04297681129671E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.95991994728208E-4
lung cancer 4473 2.16693432324015E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00404262953804049
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00447367750135673
astrocytic glioma 2241 0.00765709893448634
Pick disease 1893 0.00793426995450361
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00975752238863775
ependymoma 2514 0.0111490425768931
ovarian cancer 8492 0.0139960663686875

Expression

Synonym

Accession Q12829 Q8WVG3
Symbols RAR
SEC4L

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
25790780 High expression level of Rab40b was significantly correlated with gastric cancer invasion and lymph node metastasis.
23902685 Rab40b mediates trafficking of MMP2/9 during invadopodia formation and metastasis of breast cancer cells.

AA Sequence

MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVD    141 - 210
KLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS      211 - 278
//

Text Mined References (8)

PMID Year Title
25790780 2015 Rab40b upregulation correlates with the prognosis of gastric cancer by promoting migration, invasion, and metastasis.
23902685 2013 Rab40b regulates trafficking of MMP2 and MMP9 during invadopodia formation and invasion of breast cancer cells.
22042847 2011 Proteolytic targeting of Rab29 by an effector protein distinguishes the intracellular compartments of human-adapted and broad-host Salmonella.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.