Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.45
PubTator Score 80.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q12829 Q8WVG3
Symbols RAR
SEC4L

Gene

Gene RIF (2)

PMID Text
25790780 High expression level of Rab40b was significantly correlated with gastric cancer invasion and lymph node metastasis.
23902685 Rab40b mediates trafficking of MMP2/9 during invadopodia formation and metastasis of breast cancer cells.

AA Sequence

MSALGSPVRAYDFLLKFLLVGDSDVGKGEILASLQDGAAESPYGHPAGIDYKTTTILLDGRRVKLQLWDT      1 - 70
SGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGIDRWIKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQ     71 - 140
AQAYAERLGVTFFEVSPLCNFNITESFTELARIVLLRHGMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVD    141 - 210
KLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS      211 - 278
//

Text Mined References (8)

PMID Year Title
25790780 2015 Rab40b upregulation correlates with the prognosis of gastric cancer by promoting migration, invasion, and metastasis.
23902685 2013 Rab40b regulates trafficking of MMP2 and MMP9 during invadopodia formation and invasion of breast cancer cells.
22042847 2011 Proteolytic targeting of Rab29 by an effector protein distinguishes the intracellular compartments of human-adapted and broad-host Salmonella.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.