Property Summary

NCBI Gene PubMed Count 34
Grant Count 24
R01 Count 16
Funding $5,168,680.83
PubMed Score 87.78
PubTator Score 48.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
22201876 report dual roles for trophinin in human cancers in terms of promoting malignancy in some tumor types and suppressing it in others
21191175 Trophinin induced apoptosis in endometrial epithelial cells through protein kinase C-delta.
20237496 Observational study of gene-disease association. (HuGE Navigator)
18846386 Overexpression of trophinin leads to a more invasive phenotype and metastatic potential in human gallbladder cancer transfected into nude mice.
18078818 results provide a mechanism for trophinin-mediated adhesion of human blastocyst to endometrium by a spatially and temporally restricted paracrine effect of hCG derived from the blastocyst
17597582 These findings underscore the importance of TRO in tumorigenesis, and suggest that TRO may be a useful biomarker for cisplatin sensitivity and invasive potential.
17597582 TROPHONIN (TRO) is among the genes most downregulated by RAS. TRO expression is higher in cisplatin-sensitive cancer cell lines and positively correlates with prognoses in ovarian cancers.
17559068 Confocal microscopy analysis of ectopically expressed magphinins revealed that magphinin-alpha and -beta localize in the cytoplasm, whereas magphinin-gamma lacking the peptide encoded by exon-3 is nuclear.
17559068 When magphinin-gamma was expressed in NIH3T3 cells, cells underwent G1 arrest. These results suggest that human magphinin-gamma inhibits cell cycle progression through nuclear activity.
17495530 Trophinin functions as an adhesion molecule on the cell surface and as a molecular switch for trophoblast activation in the cytoplasm.
More...

AA Sequence

MDRRNDYGYRVPLFQGPLPPPGSLGLPFPPDIQTETTEEDSVLLMHTLLAATKDSLAMDPPVVNRPKKSK      1 - 70
TKKAPIKTITKAAPAAPPVPAANEIATNKPKITWQALNLPVITQISQALPTTEVTNTQASSVTAQPKKAN     71 - 140
KMKRVTAKAAQGSQSPTGHEGGTIQLKSPLQVLKLPVISQNIHAPIANESASSQALITSIKPKKASKAKK    141 - 210
AANKAIASATEVSLAATATHTATTQGQITNETASIHTTAASIRTKKASKARKTIAKVINTDTEHIEALNV    211 - 280
TDAATRQIEASVVAIRPKKSKGKKAASRGPNSVSEISEAPLATQIVTNQALAATLRVKRGSRARKAATKA    281 - 350
RATESQTPNADQGAQAKIASAQTNVSALETQVAAAVQALADDYLAQLSLEPTTRTRGKRNRKSKHLNGDE    351 - 420
RSGSNYRRIPWGRRPAPPRDVAILQERANKLVKYLLVKDQTKIPIKRSDMLRDVIQEYDEYFPEIIERAS    421 - 490
YTLEKMFRVNLKEIDKQSSLYILISTQESSAGILGTTKDTPKLGLLMVILSVIFMNGNKASEAVIWEVLR    491 - 560
KLGLRPGVRHSLFGEVRKLITDEFVKQKYLEYKRVPNSRPPEYEFFWGLRSYHETSKMKVLKFACRVQKK    561 - 630
DPKDWAVQYREAVEMEVQAAAVAVAEAEARAEARAQMGIGEEAVAGPWNWDDMDIDCLTREELGDDAQAW    631 - 700
SRFSFEIEARAQENADASTNVNFSRGASTRAGFSDGASISFNGAPSSSGGFSGGPGITFGVAPSTSASFS    701 - 770
NTASISFGGTLSTSSSFSSAASISFGCAHSTSTSFSSEASISFGGMPCTSASFSGGVSSSFSGPLSTSAT    771 - 840
FSGGASSGFGGTLSTTAGFSGVLSTSTSFGSAPTTSTVFSSALSTSTGFGGILSTSVCFGGSPSSSGSFG    841 - 910
GTLSTSICFGGSPCTSTGFGGTLSTSVSFGGSSSTSANFGGTLSTSICFDGSPSTGAGFGGALNTSASFG    911 - 980
SVLNTSTGFGGAMSTSADFGGTLSTSVCFGGSPGTSVSFGSALNTNAGYGGAVSTNTDFGGTLSTSVCFG    981 - 1050
GSPSTSAGFGGALNTNASFGCAVSTSASFSGAVSTSACFSGAPITNPGFGGAFSTSAGFGGALSTAADFG   1051 - 1120
GTPSNSIGFGAAPSTSVSFGGAHGTSLCFGGAPSTSLCFGSASNTNLCFGGPPSTSACFSGATSPSFCDG   1121 - 1190
PSTSTGFSFGNGLSTNAGFGGGLNTSAGFGGGLGTSAGFSGGLSTSSGFDGGLGTSAGFGGGPGTSTGFG   1191 - 1260
GGLGTSAGFSGGLGTSAGFGGGLVTSDGFGGGLGTNASFGSTLGTSAGFSGGLSTSDGFGSRPNASFDRG   1261 - 1330
LSTIIGFGSGSNTSTGFTGEPSTSTGFSSGPSSIVGFSGGPSTGVGFCSGPSTSGFSGGPSTGAGFGGGP   1331 - 1400
NTGAGFGGGPSTSAGFGSGAASLGACGFSYG                                          1401 - 1431
//

Text Mined References (35)

PMID Year Title
24713374 2014 KIAA1114, a full-length protein encoded by the trophinin gene, is a novel surface marker for isolating tumor-initiating cells of multiple hepatocellular carcinoma subtypes.
23092983 2012 Analysis of the chromosome X exome in patients with autism spectrum disorders identified novel candidate genes, including TMLHE.
22201876 2012 Trophinin in cell adhesion and signal transduction.
21191175 2011 Trophinin-mediated cell adhesion induces apoptosis of human endometrial epithelial cells through PKC-?.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18846386 2009 Enhanced expression of trophinin promotes invasive and metastatic potential of human gallbladder cancer cells.
18769125 2008 Trophinin: what embryo implantation teaches us about human cancer.
18078818 2008 Induction of trophinin in human endometrial surface epithelia by CGbeta and IL-1beta.
17597582 2007 Trophinin is a potent prognostic marker of ovarian cancer involved in platinum sensitivity.
17559068 2008 Nuclear localization of magphinins, alternative splicing products of the human trophinin gene.
More...