Property Summary

NCBI Gene PubMed Count 35
PubMed Score 89.68
PubTator Score 48.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 2.6e-03
Alzheimer's disease -1.100 1.6e-02
glioblastoma -1.200 9.7e-03
group 4 medulloblastoma 1.400 1.4e-04
intraductal papillary-mucinous adenoma (... -1.400 1.9e-06
intraductal papillary-mucinous carcinoma... -1.300 8.5e-05
intraductal papillary-mucinous neoplasm ... -1.400 3.3e-04
lung carcinoma 1.500 1.7e-23
malignant mesothelioma 1.200 6.7e-06
non-inflammatory breast cancer -1.400 1.2e-02
oligodendroglioma 1.200 9.4e-03
osteosarcoma 1.654 3.7e-02
ovarian cancer -2.800 1.8e-08
Pick disease -1.500 2.4e-04
posterior fossa group B ependymoma -1.100 9.3e-05

Synonym

Accession Q12816 B1AKE9 B1AKF1 F5GY27 Q96SX2 Q9NU89 Q9UPN8
Symbols MAGED3
MAGE-d3

Gene

TRO

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Mouse EggNOG Inparanoid

Gene RIF (17)

AA Sequence

MDRRNDYGYRVPLFQGPLPPPGSLGLPFPPDIQTETTEEDSVLLMHTLLAATKDSLAMDPPVVNRPKKSK      1 - 70
TKKAPIKTITKAAPAAPPVPAANEIATNKPKITWQALNLPVITQISQALPTTEVTNTQASSVTAQPKKAN     71 - 140
KMKRVTAKAAQGSQSPTGHEGGTIQLKSPLQVLKLPVISQNIHAPIANESASSQALITSIKPKKASKAKK    141 - 210
AANKAIASATEVSLAATATHTATTQGQITNETASIHTTAASIRTKKASKARKTIAKVINTDTEHIEALNV    211 - 280
TDAATRQIEASVVAIRPKKSKGKKAASRGPNSVSEISEAPLATQIVTNQALAATLRVKRGSRARKAATKA    281 - 350
RATESQTPNADQGAQAKIASAQTNVSALETQVAAAVQALADDYLAQLSLEPTTRTRGKRNRKSKHLNGDE    351 - 420
RSGSNYRRIPWGRRPAPPRDVAILQERANKLVKYLLVKDQTKIPIKRSDMLRDVIQEYDEYFPEIIERAS    421 - 490
YTLEKMFRVNLKEIDKQSSLYILISTQESSAGILGTTKDTPKLGLLMVILSVIFMNGNKASEAVIWEVLR    491 - 560
KLGLRPGVRHSLFGEVRKLITDEFVKQKYLEYKRVPNSRPPEYEFFWGLRSYHETSKMKVLKFACRVQKK    561 - 630
DPKDWAVQYREAVEMEVQAAAVAVAEAEARAEARAQMGIGEEAVAGPWNWDDMDIDCLTREELGDDAQAW    631 - 700
SRFSFEIEARAQENADASTNVNFSRGASTRAGFSDGASISFNGAPSSSGGFSGGPGITFGVAPSTSASFS    701 - 770
NTASISFGGTLSTSSSFSSAASISFGCAHSTSTSFSSEASISFGGMPCTSASFSGGVSSSFSGPLSTSAT    771 - 840
FSGGASSGFGGTLSTTAGFSGVLSTSTSFGSAPTTSTVFSSALSTSTGFGGILSTSVCFGGSPSSSGSFG    841 - 910
GTLSTSICFGGSPCTSTGFGGTLSTSVSFGGSSSTSANFGGTLSTSICFDGSPSTGAGFGGALNTSASFG    911 - 980
SVLNTSTGFGGAMSTSADFGGTLSTSVCFGGSPGTSVSFGSALNTNAGYGGAVSTNTDFGGTLSTSVCFG    981 - 1050
GSPSTSAGFGGALNTNASFGCAVSTSASFSGAVSTSACFSGAPITNPGFGGAFSTSAGFGGALSTAADFG   1051 - 1120
GTPSNSIGFGAAPSTSVSFGGAHGTSLCFGGAPSTSLCFGSASNTNLCFGGPPSTSACFSGATSPSFCDG   1121 - 1190
PSTSTGFSFGNGLSTNAGFGGGLNTSAGFGGGLGTSAGFSGGLSTSSGFDGGLGTSAGFGGGPGTSTGFG   1191 - 1260
GGLGTSAGFSGGLGTSAGFGGGLVTSDGFGGGLGTNASFGSTLGTSAGFSGGLSTSDGFGSRPNASFDRG   1261 - 1330
LSTIIGFGSGSNTSTGFTGEPSTSTGFSSGPSSIVGFSGGPSTGVGFCSGPSTSGFSGGPSTGAGFGGGP   1331 - 1400
NTGAGFGGGPSTSAGFGSGAASLGACGFSYG                                          1401 - 1431
//

Text Mined References (36)

PMID Year Title