Property Summary

NCBI Gene PubMed Count 15
PubMed Score 65.54
PubTator Score 104.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
ovarian cancer 8520 1.2e-11
osteosarcoma 7950 1.2e-06
psoriasis 6694 6.2e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.315 1.2e-06
ovarian cancer 1.200 1.2e-11
psoriasis 1.400 6.2e-04

Gene RIF (5)

AA Sequence

MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK      1 - 70
KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (16)

PMID Year Title