Property Summary

NCBI Gene PubMed Count 13
Grant Count 29
R01 Count 25
Funding $1,864,117.83
PubMed Score 54.83
PubTator Score 104.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.400 0.001
osteosarcoma 1.315 0.000
ovarian cancer 1.200 0.000

Gene RIF (3)

PMID Text
25261648 CETN1 is overexpressed in breast cancer tissue and promotes cells'proliferation, tumor growth and metastasis.
16760425 These data demonstrate a functional role for CaM binding to CP110 and suggest that CP110 cooperates with CaM and centrin to regulate progression through cytokinesis.
16101678 Studies using a combined approach of immunofluorescence detection of Gag protein and in situ hybridization detection of viral genomic RNA indicate Gag co-localizes with Psi+ RNA in the perinuclear region and also co-localizes with centrins

AA Sequence

MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMK      1 - 70
KMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDE     71 - 140
ELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY                                          141 - 172
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25261648 Knockdown of CETN1 inhibits breast cancer cells proliferation.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24252580 2013 CETN1 is a cancer testis antigen with expression in prostate and pancreatic cancers.
20643351 2010 Pitchfork regulates primary cilia disassembly and left-right asymmetry.
18331714 2008 sSgo1, a major splice variant of Sgo1, functions in centriole cohesion where it is regulated by Plk1.
16760425 2006 CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability.
16246726 2005 The GIT-associated kinase PAK targets to the centrosome and regulates Aurora-A.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...