Property Summary

NCBI Gene PubMed Count 19
Grant Count 6
Funding $748,603.1
PubMed Score 12.22
PubTator Score 7.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.905 0.001
astrocytic glioma 1.100 0.021
ependymoma 1.100 0.019
psoriasis 1.200 0.000
osteosarcoma 1.031 0.022
glioblastoma 1.100 0.000
non-small cell lung cancer 1.090 0.000
lung cancer 1.100 0.021
pediatric high grade glioma 1.200 0.000
ovarian cancer 1.400 0.034
dermatomyositis 1.100 0.013

Gene RIF (10)

PMID Text
23340433 An interleukin-6 family member, interleukin-11 is identified as a secondary target of twinfilin 1 in the microRNA-30c signalling pathway.
23224145 TWF1 and VIM are required for miR-30c to regulate breast cancer cell invasion.
20571053 protein overexpression promotes cardiomyocyte hypertrophy
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of twinfilin, actin-binding protein, homolog 1 (TWF1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
12807912 mammals have two twinfilin isoforms, which are differentially expressed and regulated through distinct cellular signaling pathways
12775419 Genes, including GABRP, ADF, HINT, PRSS2, SDCBP, PTK9, PPP2R5B, ITGA3, PRKCBP1, HMOX2, HAT1, PPP1cB, and ICAM-1, are upregulated after treatment of human astrocytes with HIV-1 gp120
12429826 These data suggest that the association with an actin monomer induces a first-order conformational change within the twinfilin molecule.

AA Sequence

MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDKDYDSFVLPLLEDKQPCYIL      1 - 70
FRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDEVFGTVKEDVSLHGYKKYLLS     71 - 140
QSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNE    141 - 210
IIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSRLL    211 - 280
EIVERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAETEATTD    281 - 350
//

Text Mined References (27)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23340433 2013 MicroRNA-30c inhibits human breast tumour chemotherapy resistance by regulating TWF1 and IL-11.
23224145 2013 MicroRNA-30c targets cytoskeleton genes involved in breast cancer cell invasion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20571053 2010 Attenuation of microRNA-1 derepresses the cytoskeleton regulatory protein twinfilin-1 to provoke cardiac hypertrophy.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
More...