Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.36
PubTator Score 7.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Lymphoma 81 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Baraitser-Winter syndrome 12 4.407 2.2
Sleeping sickness 37 3.604 1.8

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 2.1e-02
dermatomyositis 1.100 1.3e-02
ependymoma 1.100 1.9e-02
glioblastoma 1.100 2.3e-05
lung cancer 1.100 2.1e-02
Multiple myeloma 1.905 1.2e-03
non-small cell lung cancer 1.090 3.3e-20
osteosarcoma 1.031 2.2e-02
ovarian cancer 1.400 3.4e-02
pediatric high grade glioma 1.200 1.1e-04
psoriasis 1.200 4.9e-04

Gene RIF (10)

AA Sequence

MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVIGSYSQPSDSWDKDYDSFVLPLLEDKQPCYIL      1 - 70
FRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDEVFGTVKEDVSLHGYKKYLLS     71 - 140
QSSPAPLTAAEEELRQIKINEVQTDVGVDTKHQTLQGVAFPISREAFQALEKLNNRQLNYVQLEIDIKNE    141 - 210
IIILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEGDYLESIVFIYSMPGYTCSIRERMLYSSCKSRLL    211 - 280
EIVERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAETEATTD    281 - 350
//

Text Mined References (28)

PMID Year Title