Property Summary

NCBI Gene PubMed Count 18
Grant Count 4
Funding $88,131.96
PubMed Score 54.88
PubTator Score 37.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (14)

PMID Text
23252400 Dysfunctional ST3GAL3 may result in perturbation of the posttranslational sialylation of proteins in these pathways
21907012 ST3GAL3 mutations impair the development of higher cognitive functions.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19781661 Expression of ST3Gal IV in several gastrointestinal cell lines is correlated with the expression of sialyl Lewis x at the cell surface.
18854154 Knockdown of ST3 beta-galactoside alpha-2,3-sialyltransferase 3 (ST3GAL3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15316282 Identification of a new ST3Gal3 transcript from fetal brain.
12931020 High levels of ST3GAL-III in the tumor tissue correlated with secondary local tumor recurrence (p = 0.005; p = 0.012).
12815231 19 different transcripts of ST3GalIII were isolated and cloned; tissue distribution analysis showed complex patterns in neural and muscular tissues
12697334 Characterization of the promoter region of the ST3Gal III gene.
2829950 Oligosaccharide side-chains of HIV-1 gp160 are processed by glycosidase I and II, mannosidase I and II, acetylglucosaminyl transferase I and II, and fucosyl, galactosyl and sialyl transferases in both the endoplasmic reticulum and golgi apparatus
More...

AA Sequence

MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKL      1 - 70
PAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAIL     71 - 140
SVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYP    141 - 210
EGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEA    211 - 280
AFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTH    281 - 350
NIQREKEFLRKLVKARVITDLSSGI                                                 351 - 375
//

Text Mined References (19)

PMID Year Title
23252400 2013 West syndrome caused by ST3Gal-III deficiency.
22959728 2013 Age of onset of amyotrophic lateral sclerosis is modulated by a locus on 1p34.1.
21907012 2011 ST3GAL3 mutations impair the development of higher cognitive functions.
21782286 2011 A genome-wide association study of aging.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19781661 2010 Differential expression of alpha-2,3-sialyltransferases and alpha-1,3/4-fucosyltransferases regulates the levels of sialyl Lewis a and sialyl Lewis x in gastrointestinal carcinoma cells.
19727557 2010 Localization of Golgi-resident glycosyltransferases.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17120046 2007 Homozygosity mapping in consanguineous families reveals extreme heterogeneity of non-syndromic autosomal recessive mental retardation and identifies 8 novel gene loci.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...