Property Summary

NCBI Gene PubMed Count 21
PubMed Score 54.99
PubTator Score 37.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKL      1 - 70
PAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAIL     71 - 140
SVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYP    141 - 210
EGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEA    211 - 280
AFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTH    281 - 350
NIQREKEFLRKLVKARVITDLSSGI                                                 351 - 375
//

Text Mined References (22)

PMID Year Title