Property Summary

NCBI Gene PubMed Count 124
Grant Count 90
R01 Count 26
Funding $10,911,706.34
PubMed Score 1070.95
PubTator Score 527.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q10981 Q0VAG5 Q14338 Q5D0G2
Symbols SE
Se2
sej
SEC2
B12QTL1

Gene

PANTHER Protein Class (2)

Gene RIF (95)

PMID Text
26454189 The FUT2 gene as a putative susceptibility determinant for rotavirus infection.
26389824 Severe rotavirus gastroenteritis was virtually absent among US children who had a genetic polymorphism that inactivates FUT2 expression on the intestinal epithelium
26231005 Polyphasic approach for microbiota analysis points out that the host secretor status (FUT2 genotype) affects the gut microbiota during pregnancy. This may lead to altered infant gut microbiota colonization
26061595 In more than 1000 patients with pancreatitis, we confirmed that FUT2 non-secretor status and blood type B are also disease risk factors, with a greater than twofold OR for blood type B compared with blood type O.
25814649 No association was found between FUT2 and ABO single nucleotide polymorphism (SNPs) and chronic pancreatitis.
25761312 data confirm the hypothesis that the h2 allele is linked to Se(357, 716), and the concurrence of unique FUT1 and FUT2 mutations is geographically specific.
25744498 Functional FUT2 status is associated with norovirus infection and varies by ancestry.
25642664 the FUT 2 polymorphism does not affect outcome in very-low-birth-weight infants
25505295 Studied the incidence of norovirus gastroenteritis from birth to age 3 years, (2) the protective effect of norovirus infection against subsequent infection/disease, and (3) the association of infection and disease with FUT2 secretor status.
25037042 This study indicates that secretor genotypes determine susceptibility to GII.4 and GII.3 norovirus infections but individuals with weak secretor phenotype are not fully protected from norovirus GII.3 and GII.4 infections.
More...

AA Sequence

MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIG      1 - 70
RLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHI     71 - 140
PGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMP    141 - 210
KVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQ    211 - 280
CNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH           281 - 343
//

Text Mined References (126)

PMID Year Title
26454189 2016 Association of elevated rotavirus-specific antibody titers with HBGA secretor status in Swedish individuals: The FUT2 gene as a putative susceptibility determinant for infection.
26389824 2015 Epidemiologic Association Between FUT2 Secretor Status and Severe Rotavirus Gastroenteritis in Children in the United States.
26231005 2015 Secretor Status Is Strongly Associated with Microbial Alterations Observed during Pregnancy.
26061595 2016 ABO blood type B and fucosyltransferase 2 non-secretor status as genetic risk factors for chronic pancreatitis.
25814649 2016 Genetic variants of lipase activity in chronic pancreatitis.
25761312 2015 Genomic analysis of para-Bombay individuals in south-eastern China: the possibility of linkage and disequilibrium between FUT1 and FUT2.
25744498 2015 Innate Susceptibility to Norovirus Infections Influenced by FUT2 Genotype in a United States Pediatric Population.
25642664 2015 FUT 2 polymorphism and outcome in very-low-birth-weight infants.
25505295 2015 Norovirus Infection and Disease in an Ecuadorian Birth Cohort: Association of Certain Norovirus Genotypes With Host FUT2 Secretor Status.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
More...