Property Summary

NCBI Gene PubMed Count 124
PubMed Score 1070.95
PubTator Score 527.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
psoriasis 2.500 7.2e-125
urothelial carcinoma -1.400 1.2e-02
non-small cell lung cancer 1.474 2.4e-15
intraductal papillary-mucinous adenoma (... 2.000 1.0e-03
intraductal papillary-mucinous carcinoma... 1.800 1.0e-02
intraductal papillary-mucinous neoplasm ... 3.200 9.2e-04
lung cancer 1.500 2.1e-03
colon cancer -1.100 3.1e-02
active Crohn's disease 1.066 9.3e-03
active ulcerative colitis 1.075 2.0e-02
pancreatic cancer 1.600 1.7e-05
lung adenocarcinoma 1.600 1.6e-13
nasopharyngeal carcinoma -1.400 7.1e-09
spina bifida -1.104 4.0e-02

Gene RIF (95)

PMID Text
26454189 The FUT2 gene as a putative susceptibility determinant for rotavirus infection.
26389824 Severe rotavirus gastroenteritis was virtually absent among US children who had a genetic polymorphism that inactivates FUT2 expression on the intestinal epithelium
26231005 Polyphasic approach for microbiota analysis points out that the host secretor status (FUT2 genotype) affects the gut microbiota during pregnancy. This may lead to altered infant gut microbiota colonization
26061595 In more than 1000 patients with pancreatitis, we confirmed that FUT2 non-secretor status and blood type B are also disease risk factors, with a greater than twofold OR for blood type B compared with blood type O.
25814649 No association was found between FUT2 and ABO single nucleotide polymorphism (SNPs) and chronic pancreatitis.
25761312 data confirm the hypothesis that the h2 allele is linked to Se(357, 716), and the concurrence of unique FUT1 and FUT2 mutations is geographically specific.
25744498 Functional FUT2 status is associated with norovirus infection and varies by ancestry.
25642664 the FUT 2 polymorphism does not affect outcome in very-low-birth-weight infants
25505295 Studied the incidence of norovirus gastroenteritis from birth to age 3 years, (2) the protective effect of norovirus infection against subsequent infection/disease, and (3) the association of infection and disease with FUT2 secretor status.
25037042 This study indicates that secretor genotypes determine susceptibility to GII.4 and GII.3 norovirus infections but individuals with weak secretor phenotype are not fully protected from norovirus GII.3 and GII.4 infections.
24828903 the role of mutated FUT2 in the pathophysiology of primary sclerosing cholangitis and Crohn's disease (Review)
24733310 Secretor status and FUT2 polymorphism are associated with the composition of human intestinal microbiota.
24720527 Polymorphic locus of FUT2 (rs1047781) in CD susceptibility in Chinese population.
24612312 FUT2 is an important genetic risk factor for host-microbial diversity and disease progression in primary sclerosing cholangitis
24527852 Three new alleles in FUT1 and FUT2 genes were identified in the study. The allelic polymorphisms of FUT1 and FUT2 in Tibetans show a population-specific manner.
24326010 In this Iranian cohort, rs632111 at the 3'UTR of FUT2 was associated with Behcet's disease.
24277741 The lack of alpha1,2fucosylated carbohydrate motifs in the gut surface mucosa is thus associated with resistance to symptomatic infection and virus attachment to such motifs is essential to the infection process.
24122375 Fucosyltransferase 2 (FUT2), the main synthetic enzyme of Globo H, was also increased in HCC cells overexpressing HBV X protein (HBX).
23958938 Use of FUT2/3 genotype-dependent cut-off values for CA19-9 improved sensitivity and reduced the number of false positive results
23402911 study reports that FUT2 secretor variant influences GIF secretion in B12 deficient cases bearing GIF heterozygous mutations, in absence of H. pylori related gastritis
23201895 our study reveals that vegetarian diet along with polymorphism in the FUT2 gene may contribute significantly to the high prevalence of vitamin B(12) deficiency in India.
23075394 Celiac disease showed significant genotypic [P = 0.0074, odds ratio (OR): 1.28] and recessive (P = 0.015, OR: 1.28) association with the rs601338-AA genotype.
23065099 These data suggest a novel role for Fut2 as a regulator of angiogenesis.
23002346 Functionally relevant FUT2 gene variants are associated with ulcerative colitis (UC).
22672431 FUT2 SNPs were not associated with venous thrombosis risk.
22664149 Compared to group A/non-secretors, group O/non-secretor individuals were at increased risk of carrying S. aureus in their throat. This findings supports a role of histo-blood group antigens as ligands for S. aureus and determinants of individual colonization patterns.
22664149 Compared to group A/non-secretors, group O/non-secretor individuals were at increased risk of carrying S. aureus in their throat.Histo-blood group antigens appear to act as ligands for S. aureus and may contribute to the observed population variation in pharyngeal S. aureus colonization.
22521342 FUT2 secretor status and genotype defined by rs601338 significantly influence biliary microbial community composition in primary sclerosing cholangitis (PSC)patients.
22471454 down-regulation of ABO/FUT2 gene transcription is associated with lung cancer.
22266267 The results suggested that FUT1 C35T was a polymorphism in the Chinese population and did not affect its mRNA transcription, but could slightly decrease the activity of human alpha-(1,2)-fucosyltransferase in vitro
22237057 This study confirms the influence of FUT2 461 G-->A polymorphism on plasma vitamin B-12 concentration and showed no influence of H. pylori serologic status on this association in ambulatory subjects from Europe and West Africa.
22188519 Genetic variation of FUT2 in a Vietnamese population.
22068912 FUT2 is an important genetic factor influencing microbial diversity in the colonic mucosa.
22053055 Macrophage-derived factors including LIF might facilitate development of an implantation-receptive endometrium by regulating surface glycan structures in epithelial cells by up-regulating FUT1 and FUT2.
22025780 genetic association studies: The nonsecretor A/A genotype for FUT2 at a nonsense mutation (rs601338A>G) is associated with susceptibility to type 1 diabetes in both case-control (Great Britain) and family studies (Europe/North America/Asia).
22025362 Norovirus infection is a unique example where a single nucleotide mutation in a fucosyltransferase gene plays a crucial role in susceptibility to one of the most common viral diseases.
21725903 FUT2 secretor status was associated with colonic-type Crohn's disease
21625510 Non-functional enzyme resulting from a nonsense mutation in the FUT2 gene leads to the non-secretor phenotype
21256510 Secretor genotype and phenotype may provide strong predictive biomarkers of adverse outcomes in premature infants.
21056528 data suggest intrauterine selection against ABH secretor Se- of the embryo carried by a Se+ mother
21040203 secretor phenotype of couples with repeated spontaneous abortion, especially of the husband, could facilitate 'reproductive success'
20971884 Observational study of gene-disease association. (HuGE Navigator)
20880207 The TaqMan real-time PCR method was able to detect the number of copies of FUT2 and distinguish different kinds of known CNVs.
20852008 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20570966 FUT2 non-secretor status is associated with Crohn's disease.
20570966 Genome-wide association study of gene-disease association. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20533259 A novel 235G>C mutation of FUT1 gene which was associated with para-Bombay phenotype was found in the Chinese pedigree.
20514537 Nonsecretor genotype was associated with axillary lymph node metastasis in women with invasive ductal breast carcinoma
20514537 Observational study of gene-disease association. (HuGE Navigator)
20506485 Data show that si-RNA induced down-regulation of FUT1 and FUT2 reduced expression of fucosylated nucleolin glycoforms and their exposure at the cell surface.
20197723 Observational study of gene-disease association. (HuGE Navigator)
20172014 Transfection of the alpha1,2-fucosyltransferase gene into ovarian carcinoma-derived cells brought about elevated expression of integrin alpha5beta1 with Le(Y).
20000042 The FUT2/01 locus exhibits high heterozygosity and individual identification power in Chinese Han population.
19757028 The correlation between saliva phenotypes and sequence variation at the FUT2 gene in sixty seven individuals from northern Portugal, was assessed to characterize the functionality of FUT2 variants.
19757028 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19572973 Multiple common and sporadic sequence variations including 14 new alleles at FUT1, FUT2, and FUT3 loci were identified.
19487333 The coding region of FUT2 was resequenced in 732 individuals from 39 worldwide human populations.
19440360 The G428A nonsense mutation in FUT2 provides strong but not absolute protection against symptomatic GII.4 Norovirus infection.
19303062 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
19169360 Observational study of gene-disease association. (HuGE Navigator)
18997004 A gene region immediately upstream the transcription start site of FUT2 which has undergone non-neutral evolution independently from the coding region.
18803289 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18776911 Genome-wide association study of gene-disease association. (HuGE Navigator)
18422843 Observational study of genotype prevalence. (HuGE Navigator)
18067503 hybrid allele of Sec1-FUT2-Sec1 was found; DNA sequence suggested the Sec1-FUT2-Sec1 allele contains a 275-bp sequence identical to the FUT2 sequence including a 54-bp FUT2-specific region & that might have been generated by interlocus gene conversion
17922418 Molecular genetic analysis of FUT1 and FUT2 gene was performed for seven Chinese Han individuals serologically typed as para-Bombay.
17805536 analyzed the sequence variations in the proximal promoter region of FUT2 in several human populations
17760744 Observational study of gene-disease association. (HuGE Navigator)
17655580 Observational study of genotype prevalence. (HuGE Navigator)
17655580 This study identified 18 sequence variations in the FUT2 gene, and 6 were novel; the frequencies of alleles and genotypes were also determined in Chinese and Caucasian persons.
17537929 Observational study of gene-disease association. (HuGE Navigator)
17537929 A strong correlation (P = 0.003) was found between the secretor phenotype and symptomatic disease, extending previous knowledge and confirming that nonsense mutations in the FUT2 gene provide protection against symptomatic norovirus (GGII.4) infections.
17054072 Observational study of gene-disease association. (HuGE Navigator)
16514298 Observational study of gene-disease association. (HuGE Navigator)
16306606 Observational study of gene-disease association. (HuGE Navigator)
16168124 Higher expression of Lewis y/b was more often found in high grade and poor prognosis tumours compared to good prognosis breast cancers.
16008680 Observational study of gene-disease association. (HuGE Navigator)
15809881 Observational study of genotype prevalence. (HuGE Navigator)
15757249 Finds novel tetrameric short tandem repeat (FUT2/01)located 3.8 kb from 3' end of FUT2 coding region in African and European populations
15487706 Our results suggest a regional allele preference of h-alleles associated with para-Bombay individuals in Taiwan.
15476160 Data show the nt357 c-->t mutation in their FUT2 gene of 10 para-Bombay individuals in China.
15338364 Observational study of gene-disease association. (HuGE Navigator)
15250822 Observational study of genotype prevalence. (HuGE Navigator)
12673421 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12645255 Observational study of genotype prevalence. (HuGE Navigator)
12164325 Observational study of genotype prevalence. (HuGE Navigator)
11916003 Observational study of genotype prevalence. (HuGE Navigator)
11916003 Analysis of mutations and polymorphisms reveals that Taiwan aborigines are of Austronesian derivation.
11806852 Observational study of genotype prevalence. (HuGE Navigator)
11606829 Observational study of genotype prevalence. (HuGE Navigator)
11535550 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIG      1 - 70
RLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHI     71 - 140
PGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMP    141 - 210
KVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQ    211 - 280
CNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH           281 - 343
//

Text Mined References (126)

PMID Year Title
26454189 2016 Association of elevated rotavirus-specific antibody titers with HBGA secretor status in Swedish individuals: The FUT2 gene as a putative susceptibility determinant for infection.
26389824 2015 Epidemiologic Association Between FUT2 Secretor Status and Severe Rotavirus Gastroenteritis in Children in the United States.
26231005 2015 Secretor Status Is Strongly Associated with Microbial Alterations Observed during Pregnancy.
26061595 2016 ABO blood type B and fucosyltransferase 2 non-secretor status as genetic risk factors for chronic pancreatitis.
25814649 2016 Genetic variants of lipase activity in chronic pancreatitis.
25761312 2015 Genomic analysis of para-Bombay individuals in south-eastern China: the possibility of linkage and disequilibrium between FUT1 and FUT2.
25744498 2015 Innate Susceptibility to Norovirus Infections Influenced by FUT2 Genotype in a United States Pediatric Population.
25642664 2015 FUT 2 polymorphism and outcome in very-low-birth-weight infants.
25505295 2015 Norovirus Infection and Disease in an Ecuadorian Birth Cohort: Association of Certain Norovirus Genotypes With Host FUT2 Secretor Status.
25147783 2014 Genetic Associations with Plasma B12, B6, and Folate Levels in an Ischemic Stroke Population from the Vitamin Intervention for Stroke Prevention (VISP) Trial.
25037042 2014 Genetic susceptibility to norovirus GII.3 and GII.4 infections in Chinese pediatric diarrheal disease.
25028398 2015 Fucosyltransferase 2 (FUT2) non-secretor status and blood group B are associated with elevated serum lipase activity in asymptomatic subjects, and an increased risk for chronic pancreatitis: a genetic association study.
24941225 2014 Genetic variations affecting serum carcinoembryonic antigen levels and status of regional lymph nodes in patients with sporadic colorectal cancer from Southern China.
24828903 2015 Fucosyltransferase 2: a genetic risk factor for primary sclerosing cholangitis and Crohn's disease--a comprehensive review.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24733310 2014 Faecal microbiota composition in adults is associated with the FUT2 gene determining the secretor status.
24720527 2014 Associations of FUT2 and FUT3 gene polymorphisms with Crohn's disease in Chinese patients.
24612312 2014 Fut2 genotype is a risk factor for dominant stenosis and biliary candida infections in primary sclerosing cholangitis.
24586186 2014 Genome-wide association study of metabolic traits reveals novel gene-metabolite-disease links.
24527852 2014 Sequence analysis of the human fucosyltransferase 1 and 2 genes in Tibetan blood donors: identification of three novel alleles.
24326010 2015 FUT2: filling the gap between genes and environment in Behçet's disease?
24277741 2014 A FUT2 gene common polymorphism determines resistance to rotavirus A of the P[8] genotype.
24122375 2014 Downregulation of microRNA-15b by hepatitis B virus X enhances hepatocellular carcinoma proliferation via fucosyltransferase 2-induced Globo H expression.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23958938 2013 FUT2 and FUT3 genotype determines CA19-9 cut-off values for detection of cholangiocarcinoma in patients with primary sclerosing cholangitis.
23824729 2013 Common genetic loci influencing plasma homocysteine concentrations and their effect on risk of coronary artery disease.
23402911 2013 Gastric intrinsic factor deficiency with combined GIF heterozygous mutations and FUT2 secretor variant.
23372041 2013 Novel locus including FGF21 is associated with dietary macronutrient intake.
23300138 2014 A genome wide association study of genetic loci that influence tumour biomarkers cancer antigen 19-9, carcinoembryonic antigen and ? fetoprotein and their associations with cancer risk.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23201895 2013 Common variant in FUT2 gene is associated with levels of vitamin B(12) in Indian population.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23075394 2012 Association study of FUT2 (rs601338) with celiac disease and inflammatory bowel disease in the Finnish population.
23065099 2013 A novel role for inducible Fut2 in angiogenesis.
23002346 2012 Association of fucosyltransferase 2 gene variants with ulcerative colitis in Han and Uyghur patients in China.
22672431 2012 Lack of association of non-synonymous FUT2 and ALPL polymorphisms with venous thrombosis.
22664149 2012 Staphylococcus aureus throat carriage is associated with ABO-/secretor status.
22521342 2012 Extended analysis of a genome-wide association study in primary sclerosing cholangitis detects multiple novel risk loci.
22471454 2011 Effects of ABO and FUT2 genetic transcription absence on ABH histo-blood group antigen expression in lung cancer patients.
22367966 2012 Genome-wide association study identifies novel loci associated with serum level of vitamin B12 in Chinese men.
22266267 2012 C35T mutation could slightly decrease the activity of human ?-(1,2)-fucosyltransferase.
22237057 2012 Helicobacter pylori serologic status has no influence on the association between fucosyltransferase 2 polymorphism (FUT2 461 G->A) and vitamin B-12 in Europe and West Africa.
22188519 2012 Genetic variation of FUT2 in a Vietnamese population: identification of two novel Se enzyme-inactivating mutations.
22068912 2011 Colonic mucosa-associated microbiota is influenced by an interaction of Crohn disease and FUT2 (Secretor) genotype.
22053055 2012 Macrophages regulate expression of ?1,2-fucosyltransferase genes in human endometrial epithelial cells.
22025780 2011 FUT2 nonsecretor status links type 1 diabetes susceptibility and resistance to infection.
22025362 2011 Susceptibility to winter vomiting disease: a sweet matter.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21886157 2011 Human metabolic individuality in biomedical and pharmaceutical research.
21725903 2011 Ectopic expression of blood type antigens in inflamed mucosa with higher incidence of FUT2 secretor status in colonic Crohn's disease.
21625510 2011 Secretor genotype (FUT2 gene) is strongly associated with the composition of Bifidobacteria in the human intestine.
21256510 2011 Fucosyltransferase 2 non-secretor and low secretor status predicts severe outcomes in premature infants.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21060863 2010 Four novel Loci (19q13, 6q24, 12q24, and 5q14) influence the microcirculation in vivo.
21056528 2011 ABH secretor genetic polymorphism: evidence of intrauterine selection.
21040203 2011 ABH secretor status and reproductive success in couples with primary recurrent spontaneous abortion.
20971884 2010 Variant ABO blood group alleles, secretor status, and risk of pancreatic cancer: results from the pancreatic cancer cohort consortium.
20880207 2011 TaqMan-based real-time polymerase chain reaction for detection of FUT2 copy number variations: identification of novel Alu-mediated deletion.
20852008 2010 Associations of folate, vitamin B12, homocysteine, and folate-pathway polymorphisms with prostate-specific antigen velocity in men with localized prostate cancer.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20533259 2010 [Analysis of alpha-1,2-fucosyltransferase gene mutations in a Chinese family with para-Bombay phenotype].
20514537 2010 Polymorphisms of Lewis and Secretor genes are related to breast cancer and metastasis in axillary lymph nodes.
20506485 2010 RNA-mediated gene silencing of FUT1 and FUT2 influences expression and activities of bovine and human fucosylated nucleolin and inhibits cell adhesion and proliferation.
20197723 2010 The relationship between Lewis/Secretor genotypes and serum carbohydrate antigen 19-9 levels in a Korean population.
20172014 2010 Enhancement of the adhesive and spreading potentials of ovarian carcinoma RMG-1 cells due to increased expression of integrin alpha5beta1 with the Lewis Y-structure on transfection of the alpha1,2-fucosyltransferase gene.
20000042 2009 [Polymorphic distribution of FUT2/01 in northern Han Chinese population].
19757028 2010 Infection-associated FUT2 (Fucosyltransferase 2) genetic variation and impact on functionality assessed by in vivo studies.
19744961 2009 Genome-wide significant predictors of metabolites in the one-carbon metabolism pathway.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19572973 2009 Identification of 14 new alleles at the fucosyltransferase 1, 2, and 3 loci in Styrian blood donors, Austria.
19487333 2009 A natural history of FUT2 polymorphism in humans.
19440360 2009 The G428A nonsense mutation in FUT2 provides strong but not absolute protection against symptomatic GII.4 Norovirus infection.
19303062 2009 Genome-wide association study of vitamin B6, vitamin B12, folate, and homocysteine blood concentrations.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19169360 2009 Histo-blood group gene polymorphisms as potential genetic modifiers of infection and cystic fibrosis lung disease severity.
18997004 2009 Widespread balancing selection and pathogen-driven selection at blood group antigen genes.
18803289 2008 Smoking and serum CA19-9 levels according to Lewis and secretor genotypes.
18776911 2008 Common variants of FUT2 are associated with plasma vitamin B12 levels.
18422843 2008 Genetic variation of FUT2 in Ovambos, Turks, and Mongolians.
18067503 2008 Sec1-FUT2-Sec1 hybrid allele generated by interlocus gene conversion.
17922418 2007 [Molecular genetic analysis of FUT1 and FUT2 gene in para-Bombay Chinese: a novel FUT1 allele is identified].
17805536 2008 Distinct single nucleotide polymorphism pattern at the FUT2 promoter among human populations.
17760744 2007 Evaluation of urinary CA19-9 levels in bladder cancer patients classified according to the combinations of Lewis and Secretor blood group genotypes.
17655580 2007 Systematic sequence analysis of the human fucosyltransferase 2 (FUT2) gene identifies novel sequence variations and alleles.
17537929 2007 Host genetic resistance to symptomatic norovirus (GGII.4) infections in Denmark.
17054072 2006 Antibody prevalence and titer to norovirus (genogroup II) correlate with secretor (FUT2) but not with ABO phenotype or Lewis (FUT3) genotype.
16514298 2006 A nonsense mutation (428G-->A) in the fucosyltransferase FUT2 gene affects the progression of HIV-1 infection.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16306606 2005 A homozygous nonsense mutation (428G-->A) in the human secretor (FUT2) gene provides resistance to symptomatic norovirus (GGII) infections.
16168124 2005 High expression of Lewis y/b antigens is associated with decreased survival in lymph node negative breast carcinomas.
16008680 2005 ABO/secretor genetic complex is associated with the susceptibility of childhood asthma in Taiwan.
15809881 2005 The fusion allele of the FUT2 (secretor type alpha(1,2)-fucosyltransferase) gene at a high frequency and a new se385 allele in a Korean population.
15757249 2004 A novel tetrameric short tandem repeat located in the 3' flanking region of the human ABO-secretor gene (FUT2) and association between FUT2 and FUT2/01 loci.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487706 2004 Two prevalent h alleles in para-Bombay haplotypes among 250,000 Taiwanese.
15476160 2004 [Analysis on FUT1 and FUT2 gene of 10 para-Bombay individuals in China].
15338364 2004 Association of Lewis and Secretor gene polymorphisms and Helicobacter pylori seropositivity among Japanese-Brazilians.
15250822 2004 Two new FUT2 (fucosyltransferase 2 gene) missense polymorphisms, 739G-->A and 839T-->C, are partly responsible for non-secretor status in a Caucasian population from Northern Portugal.
12692541 2003 Human susceptibility and resistance to Norwalk virus infection.
12673421 2003 ABO blood type, Lewis and Secretor genotypes, and chronic atrophic gastritis: a cross-sectional study in Japan.
12645255 2002 [Study of ABO blood group secretor type alpha(1,2)-fucosyltransferase gene polymorphism in Chinese].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12164325 2002 Genotype frequencies of 50 polymorphisms for 241 Japanese non-cancer patients.
11916003 2002 Molecular analysis of mutations and polymorphisms of the Lewis secretor type alpha(1,2)-fucosyltransferase gene reveals that Taiwan aborigines are of Austronesian derivation.
11806852 2001 Polymorphism of the human ABO-Secretor locus (FUT2) in four populations in Asia: indication of distinct Asian subpopulations.
11777923 2002 The cytoplasmic tail of alpha 1,3-galactosyltransferase inhibits Golgi localization of the full-length enzyme.
11698403 2002 Composition of Drosophila melanogaster proteome involved in fucosylated glycan metabolism.
11606829 2001 Polymorphism and distribution of the Secretor alpha(1,2)-fucosyltransferase gene in various Taiwanese populations.
11535550 2001 Polymorphisms of two fucosyltransferase genes (Lewis and Secretor genes) involving type I Lewis antigens are associated with the presence of anti-Helicobacter pylori IgG antibody.
11323419 2001 Molecular cloning, genomic mapping, and expression of two secretor blood group alpha (1,2)fucosyltransferase genes differentially regulated in mouse uterine epithelium and gastrointestinal tract.
9760207 1998 Extensive polymorphism of the FUT2 gene in an African (Xhosa) population of South Africa.
9745152 1998 Point mutations and deletion responsible for the Bombay H null and the Reunion H weak blood groups.
9299444 1997 Missense mutation of FUT1 and deletion of FUT2 are responsible for Indian Bombay phenotype of ABO blood group system.
9219535 1997 Structure and expression of the gene encoding secretor-type galactoside 2-alpha-L-fucosyltransferase (FUT2).
8755920 1996 Molecular basis for secretor type alpha(1,2)-fucosyltransferase gene deficiency in a Japanese population: a fusion gene generated by unequal crossover responsible for the enzyme deficiency.
8621666 1996 Molecular genetic analysis of the human Lewis histo-blood group system. II. Secretor gene inactivation by a novel single missense mutation A385T in Japanese nonsecretor individuals.
8018146 1993 Attachment of Helicobacter pylori to human gastric epithelium mediated by blood group antigens.
7876235 1995 Sequence and expression of a candidate for the human Secretor blood group alpha(1,2)fucosyltransferase gene (FUT2). Homozygosity for an enzyme-inactivating nonsense mutation commonly correlates with the non-secretor phenotype.
7876234 1995 Molecular cloning of a human genomic region containing the H blood group alpha(1,2)fucosyltransferase gene and two H locus-related DNA restriction fragments. Isolation of a candidate for the human Secretor blood group locus.
7656588 1995 Relative positions of two clusters of human alpha-L-fucosyltransferases in 19q (FUT1-FUT2) and 19p (FUT6-FUT3-FUT5) within the microsatellite genetic map of chromosome 19.
1763885 1991 The human chromosome 19 linkage group FUT1 (H), FUT2 (SE), LE, LU, PEPD, C3, APOC2, D19S7 and D19S9.