Property Summary

NCBI Gene PubMed Count 18
Grant Count 20
R01 Count 18
Funding $2,057,393.8
PubMed Score 31.17
PubTator Score 33.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25598079 The described cell-based assay adds a new methodology for the development and evaluation of MGAT2 inhibitors for the treatment of obesity and type 2 diabetes
24784138 Mogat2(IKO) mice increased energy expenditure although to a lesser degree than Mogat2(-/-) mice and were protected against diet-induced weight gain and associated comorbidities
24573674 MGAT2 functions as a dimeric or tetrameric protein and selectively heterodimerizes with DGAT1 in mammalian cells
20378551 Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells
12621063 MGAT2 is a monoacylglycerol acyltransferase expressed in the small intestine
12560567 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
11530211 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
9109416 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
8892864 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
More...

AA Sequence

MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNV      1 - 70
SAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRK     71 - 140
AQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGC    141 - 210
INAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQ    211 - 280
QECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTL    281 - 350
QYLTVSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV    351 - 420
AISPPRKNGGWGDIRDHELCKSYRRLQ                                               421 - 447
//

Text Mined References (17)

PMID Year Title
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25598079 2015 Cell-based assay of MGAT2-driven diacylglycerol synthesis for profiling inhibitors: use of a stable isotope-labeled substrate and high-resolution LC/MS.
24784138 2014 Intestine-specific deletion of acyl-CoA:monoacylglycerol acyltransferase (MGAT) 2 protects mice from diet-induced obesity and glucose intolerance.
24573674 2014 Monoacylglycerol acyltransferase-2 is a tetrameric enzyme that selectively heterodimerizes with diacylglycerol acyltransferase-1.
20378551 2010 Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells.
19946888 2010 Defining the membrane proteome of NK cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621063 2003 MGAT2, a monoacylglycerol acyltransferase expressed in the small intestine.
More...