Property Summary

NCBI Gene PubMed Count 18
PubMed Score 31.17
PubTator Score 33.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.20965330792008E-9
ovarian cancer 8492 7.02229156601458E-8
acute quadriplegic myopathy 1157 2.26057461094735E-6
hepatocellular carcinoma 550 3.11193401854109E-6
group 3 medulloblastoma 2254 1.30442235579138E-4
tuberculosis and treatment for 3 months 327 5.63768433027363E-4
pilocytic astrocytoma 3086 6.15899328063037E-4
gastric cancer 436 0.00203001089803021
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00320992667000579
primary Sjogren syndrome 789 0.00329000642090793
glioblastoma 5572 0.0039941504679112
pancreatic carcinoma 567 0.00482786553910002
pancreatic cancer 2300 0.00482786553910008
Multiple myeloma 1328 0.0146518686058695
Waldenstrons macroglobulinemia 765 0.0465910384238699
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 5.282 2.6
Disease Target Count Z-score Confidence
Congenital dyserythropoietic anemia 17 3.542 1.8

Expression

Synonym

Accession Q10469 B3KPC5 B3KQM0
Symbols GNT2
CDG2A
CDGS2
GNT-II
GLCNACTII

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Gene RIF (23)

PMID Text
25944901 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25598079 The described cell-based assay adds a new methodology for the development and evaluation of MGAT2 inhibitors for the treatment of obesity and type 2 diabetes
24784138 Mogat2(IKO) mice increased energy expenditure although to a lesser degree than Mogat2(-/-) mice and were protected against diet-induced weight gain and associated comorbidities
24573674 MGAT2 functions as a dimeric or tetrameric protein and selectively heterodimerizes with DGAT1 in mammalian cells
20378551 Golgi N-glycosyltransferases beta-1,2-N-acetylglucosaminyltransferase I, beta-1,2-N-acetylglucosaminyltransferase II, 1,4-galactosyltransferase I, and alpha-2,6-sialyltransferase I form both homo- and heterodimeric enzyme complexes in live cells
12621063 MGAT2 is a monoacylglycerol acyltransferase expressed in the small intestine
12560567 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
11530211 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
9109416 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
8892864 HIV-1 gp120 N-linked oligosaccharides are processed by manosidase I and II in the Golgi complex
More...

AA Sequence

MRFRIYKRKVLILTLVVAACGFVLWSSNGRQRKNEALAPPLLDAEPARGAGGRGGDHPSVAVGIRRVSNV      1 - 70
SAASLVPAVPQPEADNLTLRYRSLVYQLNFDQTLRNVDKAGTWAPRELVLVVQVHNRPEYLRLLLDSLRK     71 - 140
AQGIDNVLVIFSHDFWSTEINQLIAGVNFCPVLQVFFPFSIQLYPNEFPGSDPRDCPRDLPKNAALKLGC    141 - 210
INAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRDYAGLILFLEEDHYLAPDFYHVFKKMWKLKQ    211 - 280
QECPECDVLSLGTYSASRSFYGMADKVDVKTWKSTEHNMGLALTRNAYQKLIECTDTFCTYDDYNWDWTL    281 - 350
QYLTVSCLPKFWKVLVPQIPRIFHAGDCGMHHKKTCRPSTQSAQIESLLNNNKQYMFPETLTISEKFTVV    351 - 420
AISPPRKNGGWGDIRDHELCKSYRRLQ                                               421 - 447
//

Text Mined References (17)

PMID Year Title
25944901 2015 UDP-galactose (SLC35A2) and UDP-N-acetylglucosamine (SLC35A3) Transporters Form Glycosylation-related Complexes with Mannoside Acetylglucosaminyltransferases (Mgats).
25598079 2015 Cell-based assay of MGAT2-driven diacylglycerol synthesis for profiling inhibitors: use of a stable isotope-labeled substrate and high-resolution LC/MS.
24784138 2014 Intestine-specific deletion of acyl-CoA:monoacylglycerol acyltransferase (MGAT) 2 protects mice from diet-induced obesity and glucose intolerance.
24573674 2014 Monoacylglycerol acyltransferase-2 is a tetrameric enzyme that selectively heterodimerizes with diacylglycerol acyltransferase-1.
20378551 2010 Golgi N-glycosyltransferases form both homo- and heterodimeric enzyme complexes in live cells.
19946888 2010 Defining the membrane proteome of NK cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12621063 2003 MGAT2, a monoacylglycerol acyltransferase expressed in the small intestine.
More...