Property Summary

NCBI Gene PubMed Count 3
PubMed Score 134.18
PubTator Score 34.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Sickle Cell Anemia 53 3.468 1.7

Gene RIF (2)

AA Sequence

MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEE      1 - 70
FDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVSTRIYEKV             71 - 132
//

Text Mined References (3)

PMID Year Title