Property Summary

NCBI Gene PubMed Count 3
Grant Count 23
R01 Count 6
Funding $7,027,148.17
PubMed Score 127.56
PubTator Score 34.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Sickle cell anemia 35 3.474 1.7

Gene RIF (2)

PMID Text
18950845 Observational study of gene-disease association. (HuGE Navigator)
18803274 Serum A-FABP might be a prognostic marker of body weight loss suggesting a preventive therapeutic intervention.

AA Sequence

MVEPFLGTWKLVSSENFEDYMKELGVNFAARNMAGLVKPTVTISVDGKMMTIRTESSFQDTKISFKLGEE      1 - 70
FDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEKMVVECKMNNIVSTRIYEKV             71 - 132
//

Text Mined References (3)

PMID Year Title
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18803274 2008 Serum adipocyte-fatty acid binding protein discriminates patients with permanent and temporary body weight loss.
7958448 1994 A novel testicular protein, with sequence similarities to a family of lipid binding proteins, is a major component of the rat sperm perinuclear theca.