Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.82

Knowledge Summary


No data available


Accession Q0WX57 A8MRA9 Q0WX56 Q3BEM1


AA Sequence

SSTPTHQESMNTGTLASLRGRARRSKGKNKHSKRALLVCQ                                  491 - 530

Text Mined References (18)

PMID Year Title
21448158 2011 The deubiquitinating enzyme USP17 is essential for GTPase subcellular localization and cell motility.
21239494 2011 Lys-63-specific deubiquitination of SDS3 by USP17 regulates HDAC activity.
20715989 2010 Polyclonal and monoclonal antibodies specific for USP17, a proapoptotic deubiquitinating enzyme.
20403174 2010 The DUB/USP17 deubiquitinating enzymes: a gene family within a tandemly repeated sequence, is also embedded within the copy number variable beta-defensin cluster.
20388806 2010 The deubiquitinating enzyme USP17 is highly expressed in tumor biopsies, is cell cycle regulated, and is required for G1-S progression.
20368735 2010 The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.
20228808 2010 Ubiquitin hydrolase Dub3 promotes oncogenic transformation by stabilizing Cdc25A.
20228807 2010 Cdc25A and Dub3 in a high-stakes balancing act.
20147298 2010 The deubiquitinating enzyme USP17 blocks N-Ras membrane trafficking and activation but leaves K-Ras unaffected.
19188362 2009 USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.