Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.35
PubTator Score 9.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.045 0.011
Breast cancer 2.100 0.047
interstitial cystitis -1.100 0.001
lung carcinoma 1.200 0.000
Pick disease -1.100 0.000
progressive supranuclear palsy -1.200 0.022
ovarian cancer 1.400 0.000

AA Sequence

MEPFSCDTFVALPPATVDNRIIFGKNSDRLYDEVQEVVYFPAVVHDNLGERLKCTYIEIDQVPETYAVVL      1 - 70
SRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERADTAEKALNVIVDLLEKYGQG     71 - 140
GNCTEGRMVFSYHNSFLIADRNEAWILETAGKYWAAEKVQEGVRNISNQLSITTKIAREHPDMRNYAKRK    141 - 210
GWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA    211 - 280
SMVSILPQDSSLPCIHFFTGTPDPERSVFKPFIFVPHISQLLDTSSPTFELEDLVKKKSHFKPDRRHPLY    281 - 350
QKHQQALEVVNNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSV    351 - 420
KVSS                                                                      421 - 424
//

Text Mined References (10)

PMID Year Title
22464252 2012 Exome sequencing identifies PDE4D mutations in acrodysostosis.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221138 2002 Purification and identification of secernin, a novel cytosolic protein that regulates exocytosis in mast cells.
11238933 2001 Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.