Property Summary

NCBI Gene PubMed Count 8
PubMed Score 15.35
PubTator Score 9.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 7.28501089185899E-17
Pick disease 1893 7.63190604014295E-5
ovarian cancer 8492 1.93826196996E-4
interstitial cystitis 2299 7.93411994753063E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0107285838181891
progressive supranuclear palsy 674 0.0221252994619783
Breast cancer 3099 0.0474454887559216

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.045 0.011
Breast cancer 2.100 0.047
interstitial cystitis -1.100 0.001
lung carcinoma 1.200 0.000
Pick disease -1.100 0.000
progressive supranuclear palsy -1.200 0.022
ovarian cancer 1.400 0.000

Synonym

Accession Q0VDG4 B4DI11 C9JPC1 D3DPE0 Q7L1C5 Q9H5R5
Symbols SES3

Gene

  Ortholog (12)

 GO Function (1)

 GO Process (1)

AA Sequence

MEPFSCDTFVALPPATVDNRIIFGKNSDRLYDEVQEVVYFPAVVHDNLGERLKCTYIEIDQVPETYAVVL      1 - 70
SRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERADTAEKALNVIVDLLEKYGQG     71 - 140
GNCTEGRMVFSYHNSFLIADRNEAWILETAGKYWAAEKVQEGVRNISNQLSITTKIAREHPDMRNYAKRK    141 - 210
GWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA    211 - 280
SMVSILPQDSSLPCIHFFTGTPDPERSVFKPFIFVPHISQLLDTSSPTFELEDLVKKKSHFKPDRRHPLY    281 - 350
QKHQQALEVVNNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSV    351 - 420
KVSS                                                                      421 - 424
//

Text Mined References (10)

PMID Year Title
22464252 2012 Exome sequencing identifies PDE4D mutations in acrodysostosis.
21269460 2011 Initial characterization of the human central proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221138 2002 Purification and identification of secernin, a novel cytosolic protein that regulates exocytosis in mast cells.
11238933 2001 Antisense promoter of human L1 retrotransposon drives transcription of adjacent cellular genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.