Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary


No data available



Accession Q0VDD7 Q13411 Q8N825 Q96D63 Q9BU49


  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid

 Compartment GO Term (1)

AA Sequence

AFKRLNYRKTKLGGKAPLPYPSKGPGNIPRGDPPWREL                                    631 - 668

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8228263 1993 Identification of human pre-T/NK cell-associated genes.