Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.007
hepatocellular carcinoma -1.400 0.000
malignant mesothelioma -1.200 0.000
astrocytic glioma -1.300 0.047
oligodendroglioma -1.300 0.033
psoriasis 1.100 0.001
group 4 medulloblastoma -1.600 0.000
cystic fibrosis -1.363 0.000
glioblastoma 1.100 0.031
medulloblastoma, large-cell -1.800 0.012
adrenocortical carcinoma -1.920 0.000
non-small cell lung cancer -2.562 0.000
lung cancer -4.400 0.000
colon cancer -1.600 0.015
interstitial cystitis 1.100 0.001
subependymal giant cell astrocytoma 2.016 0.004
lung adenocarcinoma -1.686 0.000
Endometriosis -1.083 0.011
Alzheimer's disease -1.100 0.016
Pick disease -1.100 0.000
mucosa-associated lymphoid tissue lympho... 1.017 0.026
invasive ductal carcinoma -1.400 0.026
ovarian cancer -2.700 0.000
pituitary cancer -1.600 0.000
chronic rhinosinusitis -1.247 0.004
dermatomyositis 1.400 0.002

Synonym

Accession Q0VDD5 Q0VDD6
Symbols C17orf91

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
25171338 six novel lncRNAs (CDKN2B-AS1, MIR22HG, GABPB1-AS1, FLJ33630, LINC00152, and LINC0541471_v2) that respond to model chemical stresses (cycloheximide, hydrogen peroxide, cadmium, or arsenic) in hiPSCs.

AA Sequence

MGWEGPNSRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP                   1 - 57
//

Text Mined References (10)

PMID Year Title
25171338 2014 Long non-coding RNAs as surrogate indicators for chemical stress responses in human-induced pluripotent stem cells.
24036268 2013 Identification of short-lived long non-coding RNAs as surrogate indicators for chemical stress response.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.