Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma -1.920 1.0e-04
Alzheimer's disease -1.100 1.6e-02
astrocytic glioma -1.300 4.7e-02
chronic rhinosinusitis -1.247 4.1e-03
colon cancer -1.600 1.5e-02
cystic fibrosis -1.363 4.8e-05
dermatomyositis 1.400 1.9e-03
Endometriosis -1.083 1.1e-02
glioblastoma 1.100 3.1e-02
group 4 medulloblastoma -1.600 4.6e-04
hepatocellular carcinoma -1.400 3.7e-04
interstitial cystitis 1.100 6.9e-04
invasive ductal carcinoma -1.400 2.6e-02
lung adenocarcinoma -1.686 9.0e-05
lung cancer -1.700 1.2e-02
malignant mesothelioma -1.200 2.6e-06
medulloblastoma, large-cell -1.800 1.2e-02
mucosa-associated lymphoid tissue lympho... 1.017 2.6e-02
non-small cell lung cancer -2.562 4.4e-27
oligodendroglioma -1.300 3.3e-02
ovarian cancer -2.700 3.6e-08
Pick disease -1.100 2.7e-05
pituitary cancer -1.600 2.9e-06
psoriasis 1.100 8.0e-04
Rheumatoid arthritis 1.200 7.4e-03
subependymal giant cell astrocytoma 2.016 3.7e-03

Synonym

Accession Q0VDD5 Q0VDD6
Symbols C17orf91

Gene

 Compartment GO Term (0)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MGWEGPNSRVDDTFWASWRAFAQIGPARSGFRLETLAGLRSRRLKQPKAFCLRDVAP                   1 - 57
//

Text Mined References (11)

PMID Year Title