Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.41
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.300 0.006
posterior fossa group B ependymoma -3.900 0.000
oligodendroglioma -2.300 0.012
glioblastoma -2.200 0.047
medulloblastoma -5.300 0.000
atypical teratoid / rhabdoid tumor -4.500 0.000
medulloblastoma, large-cell -5.700 0.000
Pick disease -1.400 0.009
pituitary cancer 4.800 0.000

Gene RIF (1)

PMID Text
20080650 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERRLIKKEMKKLLGDYIGIRLRENEFDPKGRRQLTFLDDMAHYDLAISVALQWLDPSEDLTWLEWEELK      1 - 70
IPLHGRPIYPNRREREAMILSSYAGILMNSIPIEEVFKIYGADSSADSGTIKVPRVSSLCLSLHPFAMLT     71 - 140
APKAAAYARKQSVKSRKVTTNKNATSISAKEANATEWKSSQRFSDTQPKHKVT                     141 - 193
//

Text Mined References (6)

PMID Year Title
24055526 2013 Novel candidate genes for 46,XY gonadal dysgenesis identified by a customized 1 M array-CGH platform.
22080834 2012 Knockdown of the psychosis susceptibility gene ZNF804A alters expression of genes involved in cell adhesion.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.