Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.41
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -2.300 6.5e-03
atypical teratoid / rhabdoid tumor -4.500 1.5e-05
ependymoma -3.700 1.1e-02
glioblastoma -2.200 4.7e-02
group 3 medulloblastoma -3.800 7.7e-03
medulloblastoma, large-cell -5.700 8.4e-05
oligodendroglioma -2.300 1.2e-02
Pick disease -1.400 8.9e-03
pituitary cancer 4.800 2.6e-04

Gene RIF (1)

AA Sequence

MERRLIKKEMKKLLGDYIGIRLRENEFDPKGRRQLTFLDDMAHYDLAISVALQWLDPSEDLTWLEWEELK      1 - 70
IPLHGRPIYPNRREREAMILSSYAGILMNSIPIEEVFKIYGADSSADSGTIKVPRVSSLCLSLHPFAMLT     71 - 140
APKAAAYARKQSVKSRKVTTNKNATSISAKEANATEWKSSQRFSDTQPKHKVT                     141 - 193
//

Text Mined References (6)

PMID Year Title