Property Summary

NCBI Gene PubMed Count 18
PubMed Score 15.01
PubTator Score 13.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
interstitial cystitis -1.900 5.7e-04
medulloblastoma, large-cell 1.300 6.5e-04
osteosarcoma 1.124 5.1e-05
ovarian cancer 1.300 1.5e-14
psoriasis 1.100 8.5e-31
urothelial carcinoma -1.300 4.8e-02

Gene RIF (13)

AA Sequence

MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAPGPMELRVSNT      1 - 70
SCENGSLLHLYCSSQEVLCQIVNDLSPEVPSNATFHSWQERIRQNYGFYIGLGLAFLSSFLIGSSVILKK     71 - 140
KGLLRLVATGATRAVDGGFGYLKDAMWWAGFLTMAAGEVANFGAYAFAPATVVTPLGALSVLISAILSSY    141 - 210
FLRESLNLLGKLGCVICVAGSTVMVIHAPEEEKVTTIMEMASKMKDTGFIVFAVLLLVSCLILIFVIAPR    211 - 280
YGQRNILIYIIICSVIGAFSVAAVKGLGITIKNFFQGLPVVRHPLPYILSLILALSLSTQVNFLNRALDI    281 - 350
FNTSLVFPIYYVFFTTVVVTSSIILFKEWYSMSAVDIAGTLSGFVTIILGVFMLHAFKDLDISCASLPHM    351 - 420
HKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS                            421 - 466
//

Text Mined References (20)

PMID Year Title