Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 10.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.0e-09
group 4 medulloblastoma 1855 8.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Enamel erosion 19 3.076 1.5
Cancer 2499 3.014 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.300 8.1e-04
osteosarcoma -3.105 4.0e-09

AA Sequence

MDPVACEDVAVNFTQEEWALLDISQRKLYREVMLETFRNLTSIGKKWKDQNIEYEYQNPRRNFRSLIEGN      1 - 70
VNEIKEDSHCGETFTQVPDDRLNFQEKKASPEAKSCDNFVCGEVGIGNSSFNMNIRGDIGHKAYEYQDYA     71 - 140
PKPYKCQQPKKAFRYHPSFRTQERNHTGEKPYACKECGKTFISHSGIRRRMVMHSGDGPYKCKFCGKAVH    141 - 210
CLRLYLIHERTHTGEKPYECKQCVKSFSYSATHRIHERTHTGEKPYECQQCGKAFHSSSSFQAHKRTHTG    211 - 280
GKPYECKQCGKSFSWCHSFQIHERTHTGEKPCECSKCNKAFRSYRSYLRHKRSHTGEKPYQCKECRKAFT    281 - 350
YPSSLRRHERTHSAKKPYECKQCGKALSYKFSNTPKNALWRKTL                              351 - 394
//

Text Mined References (7)

PMID Year Title