Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ovarian cancer 8492 4.17919683676504E-16
non-small cell lung cancer 2798 2.76932776679088E-14
lung adenocarcinoma 2714 3.99437902735243E-9
Pick disease 1893 4.51629396605749E-5
ulcerative colitis 2087 1.1395956794714E-4
medulloblastoma, large-cell 6234 4.45725988246973E-4
psoriasis 6685 4.92898189181407E-4
lung cancer 4473 5.25723301438218E-4
interstitial cystitis 2299 6.5740080921358E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00399274974308367
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00475522350586117
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0247483180774229

Expression

  Differential Expression (12)

Synonym

Accession Q0D2I5 Q24JT6 Q7L5J9 Q7Z5X4 Q9BQ46
Symbols IFFO
HOM-TES-103

Gene

  Ortholog (9)

AA Sequence

MNPLFGPNLFLLQQEQQGLAGPLGDSLGGDHFAGGGDLPPAPLSPAGPAAYSPPGPGPAPPAAMALRNDL      1 - 70
GSNINVLKTLNLRFRCFLAKVHELERRNRLLEKQLQQALEEGKQGRRGLGRRDQAVQTGFVSPIRPLGLQ     71 - 140
LGARPAAVCSPSARVLGSPARSPAGPLAPSAASLSSSSTSTSTTYSSSARFMPGTIWSFSHARRLGPGLE    141 - 210
PTLVQGPGLSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEEYTVRIQLQDRVNELQEEA    211 - 280
QEADACQEELALKVEQLKAELVVFKGLMSNNLSELDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNCE    281 - 350
DMIQMFQVPSMGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCD    351 - 420
SLTWEETEETLLLWEDFSGYAMAAAEAQGEQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKND    421 - 490
MNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR     491 - 559
//

Text Mined References (10)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12032826 2002 A novel tumour associated leucine zipper protein targeting to sites of gene transcription and splicing.
8771189 1995 Intermediate filament proteins.
3052284 1988 Molecular and cellular biology of intermediate filaments.