Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q0D2H9
Symbols GOLGA8D

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MEWKLEQSMREQALLKAQLTQLKESLKEVQLERDEYAEHLKGERARWQQRMRKMSQEVCSLKKEKKHDKY      1 - 70
RVEKLERSLSKLKNQMAEPLPPEPPAVPSEVELQHLRKELERVAGALQAQVEYNQRISLLNEGQKERLRE     71 - 140
QEERLQEQQERLPEQEERLQQLAEPQNSFKELNNENKSVLQLEQQVKELQEKLGKERLEAASQQKQQLTA    141 - 210
QLSLMALPGEGHGGEHLDSEGEEAPRPMPSVPEDLESREAMSGFMDHLEEKADLSELVEKEELGFFQYYR    211 - 280
ERCHQKVYHPITKPGGSAKDAAPGGGHHQAGPGQGGDEGEAAGAAGDGVAAGGDYKGHSKFLVTAQNPAH    281 - 350
EPSPGAPAPQELGAAHKHGDLCEVSLTDSVEPVQGEAREGSPHDNPTAQPIVQDHQEHPGLGSNCCVPFF    351 - 420
CWAWLPRRRR                                                                421 - 430
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.