Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.35
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 0.7
Alzheimer's disease 658 0.0 0.7

Expression

Gene RIF (1)

AA Sequence

MSLPQPTPRMAELRKPTSSLTPPEDPDSQPPSSKRLCLEEPGGVFKAGWRLPLVPRLSEAEKVWELSPRP      1 - 70
FKGLLVSTNAIFDNSTDSCVEKSVSGKQICNLKCSNLKFQMSSCLQSPPSQSPDSDLRASGRSEAGLHDR     71 - 140
EAFSVHRSNSSKAGVSQLLPSTSIHDIHGIRNENRKQQFVQGRDNVHKENPFLDVTFYKETKSPFHEIKN    141 - 210
RCKANSVVPSNKRENNISSSVLKISKSQNQPSLEIAKPSYFRDSGTISVPQFPMDLNSKMSSVYLKEIAK    211 - 280
KKNDKKEAYVRDFTNIYWSQNRPDVKKQKLQNDKKTVEAENIFSKCYENDYPSLSSQNTCKRKDLISSNY    281 - 350
CNCSSIQCNVRDSRKNFAILENANWEEAECLDSYVLTRLEKSQNWDCNVRHILRRNRGNCWIINNCKTKC    351 - 420
ENMKKTEEKWNWLLLLEIDLLSKEDYHCAKVINAYEEQSKLLVREILGSQTALITTVWLNGKGENDNTLQ    421 - 490
LRYNTTQKVFHVNNPFESFIIEIFYFHKSISGNKKDNSILTCCNILKCKKQIGIIGIQNLITRNMNTNIK    491 - 560
NGILSIYLQDSVSEPLDILLKTNIAFLLNNFDSLTRIENDFELEEECIFKCMLYLKYPKNIVENHTAYLV    561 - 630
KILTSSRLLEDNMKPMLKKRKLFRTEQVFEKSKKKLINSFSMTTQNTGFPIFETYEKIPLLMDFDDMDEI    631 - 700
SLIREITCQNMSCPQQVVNVENWAHYNSSTVKAHGNSCPQFIQNNRGYINENFYEVNMHSQDLNMERKQG    701 - 770
HNKISNFDCEHIFEDLCNVRQQAIPASHNIIHNEETHTTSITQVLNFWNLLSEIEEKKYDLILKEEVKVT    771 - 840
AESLTNSCQVHKDTKIEKEEKDSFFPMDDMFSVQSVSLISKEVNVEENKYVNQNYVTNTNEYESILPERE    841 - 910
IANSKDFHRKNDSALYINHQFETGLSEGNDECFQDLAAKYLSTEALTIVKDFEMKRKFDLVLEELRMFHE    911 - 980
ISRENELLSTVETNNGQENYFGENDAEKVKMEIEKDLKMVVVNKIRASSSFHDTIAGPNMGKSHQSLFKW    981 - 1050
KTVPNNGEQEVPNESCYPSRSEEELLYSTSEKDCETPLPKRPAFLPDECKEEFNYLLRGGSHFPHGISRV   1051 - 1120
RPLKTCSRPIRIGLSRKARIKQLHPYLKQMCYGNLKENF                                  1121 - 1159
//

Text Mined References (3)

PMID Year Title