Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.35
PubTator Score 0.70

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


Gene RIF (1)

16990250 A novel protein, RAD51AP2, has been discovered that interacts with RAD51 through a C-terminal motif also present in RAD51AP1.

AA Sequence

RPLKTCSRPIRIGLSRKARIKQLHPYLKQMCYGNLKENF                                  1121 - 1159

Text Mined References (3)

PMID Year Title
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
16990250 2006 RAD51AP2, a novel vertebrate- and meiotic-specific protein, shares a conserved RAD51-interacting C-terminal domain with RAD51AP1/PIR51.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.