Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.43
PubTator Score 8.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Chronic obstructive pulmonary disease 184 3.145 1.6

Expression

 GO Function (1)

Gene RIF (7)

AA Sequence

MLPLLLLPLLWGGSLQEKPVYELQVQKSVTVQEGLCVLVPCSFSYPWRSWYSSPPLYVYWFRDGEIPYYA      1 - 70
EVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFRVERGRDVKYSYQQNKLNLEVT     71 - 140
ALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGPPLTFSWTGNALSPLDPETTRSSELTLTPRPEDHGTN    141 - 210
LTCQVKRQGAQVTTERTVQLNVSYAPQNLAISIFFRNGTGTALRILSNGMSVPIQEGQSLFLACTVDSNP    211 - 280
PASLSWFREGKALNPSQTSMSGTLELPNIGAREGGEFTCRVQHPLGSQHLSFILSVQRSSSSCICVTEKQ    281 - 350
QGSWPLVLTLIRGALMGAGFLLTYGLTWIYYTRCGGPQQSRAERPG                            351 - 396
//

Text Mined References (8)

PMID Year Title